DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB9 and ANNAT1

DIOPT Version :9

Sequence 1:NP_001262796.1 Gene:AnxB9 / 42492 FlyBaseID:FBgn0000083 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_174810.1 Gene:ANNAT1 / 840476 AraportID:AT1G35720 Length:317 Species:Arabidopsis thaliana


Alignment Length:305 Identity:102/305 - (33%)
Similarity:159/305 - (52%) Gaps:8/305 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVI 87
            |.:||..||.|.:|:||:|..||.|||.|...||..|.:|:..:||:||:..|..||...||..|
plant    13 PSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAI 77

  Fly    88 LALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTS 152
            |.......:..|...::|.....:..:.::|:.||.::..:....|.|...:.||||.|:...|:
plant    78 LLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTT 142

  Fly   153 GHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTFNSILITRSYQQLRQIFL 217
            |.|::|.||||...|.|...|:...|..:|:.:|:..:.:...||.... ||.|||..|:...|.
plant   143 GDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIR-ILSTRSKAQINATFN 206

  Fly   218 EYENLSGNDIEKAIKREFSGSVEKGFLAI----VKCCKSKIDYFSERLHDSMAGMGTKDKTLIRI 278
            .|::..|.:|.|:::   .|..:..|||:    ::|......||.:.|..::...||.:..|.||
plant   207 RYQDDHGEEILKSLE---EGDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRI 268

  Fly   279 IVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAIVG 323
            :.:|:||||..|.|.:|.:....||..|..||.|||::.|:|::|
plant   269 VTTRAEIDLKVIGEEYQRRNSIPLEKAITKDTRGDYEKMLVALLG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB9NP_001262796.1 Annexin 26..90 CDD:395139 30/63 (48%)
Annexin 97..162 CDD:395139 17/64 (27%)
Annexin 188..246 CDD:395139 16/57 (28%)
Annexin 256..321 CDD:395139 25/64 (39%)
ANNAT1NP_174810.1 Annexin 16..80 CDD:395139 30/63 (48%)
Annexin 87..152 CDD:395139 17/64 (27%)
Annexin 170..232 CDD:413385 18/65 (28%)
Annexin 246..311 CDD:395139 25/64 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I1373
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D856254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm965
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.840

Return to query results.
Submit another query.