DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB9 and ANNAT4

DIOPT Version :9

Sequence 1:NP_001262796.1 Gene:AnxB9 / 42492 FlyBaseID:FBgn0000083 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_181409.1 Gene:ANNAT4 / 818457 AraportID:AT2G38750 Length:319 Species:Arabidopsis thaliana


Alignment Length:311 Identity:84/311 - (27%)
Similarity:139/311 - (44%) Gaps:38/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKD-----------LISDLKSELGGKFEDVILA 89
            |.|.||.|:|..|.:.....|....:|.|:.:.:|           .:..||.|.......|::.
plant    19 GMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMW 83

  Fly    90 LMTPLPQFYAQELHDAISGLGTDEEA---IIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDT 151
            .|.|    :.::.......|...|||   |:|:.||.|...:....:.|...|.:|:|.|:....
plant    84 AMHP----WERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHV 144

  Fly   152 SGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHD--AGEGQWGTDESTFNSILITRSYQQLRQ 214
            .|..::|.|.||...|.|...|.:.:|.:||:.|.:  |..|:...::.....||.|||...|:.
plant   145 HGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVEKDEVVRILTTRSKLHLQH 209

  Fly   215 IFLEYENLSGNDIEKAIKREFSGSVEKGFL---AIVKCCKSKIDYFSERLHDSM---AGMGTKDK 273
            ::..:..:.|:|:        .|.|.|..|   |:: |......|||:.|..|:   |...|| |
plant   210 LYKHFNEIKGSDL--------LGGVSKSSLLNEALI-CLLKPALYFSKILDASLNKDADKTTK-K 264

  Fly   274 TLIRIIVSRSE--IDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAIV 322
            .|.|:.|:|::  .::.:|||.:.|.||::|...|:....|:|:..||.::
plant   265 WLTRVFVTRADHSDEMNEIKEEYNNLYGETLAQRIQEKIKGNYRDFLLTLL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB9NP_001262796.1 Annexin 26..90 CDD:395139 15/64 (23%)
Annexin 97..162 CDD:395139 17/67 (25%)
Annexin 188..246 CDD:395139 14/60 (23%)
Annexin 256..321 CDD:395139 25/69 (36%)
ANNAT4NP_181409.1 Annexin 90..155 CDD:413385 17/64 (27%)
Annexin 245..314 CDD:413385 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D856254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.