DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB9 and anxa1d

DIOPT Version :9

Sequence 1:NP_001262796.1 Gene:AnxB9 / 42492 FlyBaseID:FBgn0000083 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001017605.1 Gene:anxa1d / 550268 ZFINID:ZDB-GENE-050417-72 Length:340 Species:Danio rerio


Alignment Length:310 Identity:124/310 - (40%)
Similarity:186/310 - (60%) Gaps:0/310 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSE 78
            ||.....|:...||..|:||::..|.||.||||:||:|...||.:|..|::.|.||.|..:||..
Zfish    29 TVKADSNFNAQNDAEKLKKAIETKGVDEAAIIEVLAKRSNAQRQQIKAAYQQSAGKPLADELKKA 93

  Fly    79 LGGKFEDVILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSL 143
            |....|||:|||:....::.|.|:..|:.||||.|..:.|||.|.:|..|..:...:::.:.::|
Zfish    94 LKSHLEDVVLALLMTPSEYDAFEMRRAMKGLGTKENVLSEILGTRTNKEITALKNSFKEVYRETL 158

  Fly   144 ESDLKGDTSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTFNSILITRS 208
            |.|:|.|.||:.:.:.:||.:..|.|::.:|:..|.:||:||.:||:.:.||..|....||..||
Zfish   159 EEDIKHDVSGNLETVLLSLCKATRSEDRKIDDGLAKSDAKALFEAGKNRIGTVCSVLIDILTNRS 223

  Fly   209 YQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCCKSKIDYFSERLHDSMAGMGTKDK 273
            ..||.:||..|...|.:.:.|.::.|.||..|...:.:||...:|..||:|:|..:|.|.||.:.
Zfish   224 EAQLCKIFQYYGQFSKDGLAKDLQSELSGDFEDCMMTLVKVAWNKPAYFAEKLQHAMKGFGTNND 288

  Fly   274 TLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAIVG 323
            ||||||||||||||..|.:.::..|||:|:..|:.:|.|||::.||.:.|
Zfish   289 TLIRIIVSRSEIDLLKIMQEYKRMYGKTLQEAIQSETKGDYEKILLVLCG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB9NP_001262796.1 Annexin 26..90 CDD:395139 30/63 (48%)
Annexin 97..162 CDD:395139 21/64 (33%)
Annexin 188..246 CDD:395139 20/57 (35%)
Annexin 256..321 CDD:395139 34/64 (53%)
anxa1dNP_001017605.1 Annexin 41..105 CDD:278615 30/63 (48%)
Annexin 112..177 CDD:278615 21/64 (33%)
Annexin 196..261 CDD:278615 24/64 (38%)
Annexin 271..336 CDD:278615 34/64 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.