DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB9 and anxa7

DIOPT Version :9

Sequence 1:NP_001262796.1 Gene:AnxB9 / 42492 FlyBaseID:FBgn0000083 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_012821793.2 Gene:anxa7 / 407959 XenbaseID:XB-GENE-987772 Length:536 Species:Xenopus tropicalis


Alignment Length:328 Identity:166/328 - (50%)
Similarity:220/328 - (67%) Gaps:5/328 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAEYYPFKCT-----PTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIA 60
            |.|:..:|:...     .|:..|..||.:.||..||||||||||||:||::::|.|...||.:|.
 Frog   208 MYSSTQHPYAAAMTATQGTIKAAPNFDALSDAEKLRKAMKGFGTDEQAIVDVVANRSNDQRQKIK 272

  Fly    61 EAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSN 125
            .||||:||||||.||||||.|..|::|:||..|...:.|..|:.|:.|.||.|..:||||||.:|
 Frog   273 AAFKTAYGKDLIKDLKSELSGNVEELIIALFMPATYYDAWSLYHAMKGAGTQERVLIEILCTRTN 337

  Fly   126 YGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGE 190
            ..||.|...|:..||:.:|.|::.||||||:||.:|:.||||||||.|:...|..|||.|:.|||
 Frog   338 SEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQNVNLQQAEQDAQRLYQAGE 402

  Fly   191 GQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCCKSKID 255
            |:.|||||:||.:|.:||:.|||.:...|..:|..|:...|.|||||.:|.|..|:::|..::..
 Frog   403 GKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPA 467

  Fly   256 YFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLA 320
            :|:|||:.||.|.||.|.|||||||:||||||..||:|:...:.|||.:.|..||||||:|.|:|
 Frog   468 FFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLIA 532

  Fly   321 IVG 323
            |.|
 Frog   533 IAG 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB9NP_001262796.1 Annexin 26..90 CDD:395139 40/63 (63%)
Annexin 97..162 CDD:395139 30/64 (47%)
Annexin 188..246 CDD:395139 28/57 (49%)
Annexin 256..321 CDD:395139 38/64 (59%)
anxa7XP_012821793.2 PTZ00009 <158..195 CDD:240227
Annexin 238..302 CDD:395139 40/63 (63%)
Annexin 309..374 CDD:395139 30/64 (47%)
Annexin 392..458 CDD:395139 32/65 (49%)
Annexin 468..533 CDD:395139 38/64 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 1 1.000 - - mtm14095
Panther 1 1.100 - - O PTHR10502
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.