DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB9 and ANXA13

DIOPT Version :9

Sequence 1:NP_001262796.1 Gene:AnxB9 / 42492 FlyBaseID:FBgn0000083 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001003954.1 Gene:ANXA13 / 312 HGNCID:536 Length:357 Species:Homo sapiens


Alignment Length:302 Identity:153/302 - (50%)
Similarity:211/302 - (69%) Gaps:0/302 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFED 85
            ||...||..|.||.||.||:|.||||||:.|...:|.:|.:.:|.:|||:|...|||||.|.||.
Human    55 FDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEK 119

  Fly    86 VILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGD 150
            ..|||:....::.|::|..|:.||||||..:||:|||.:|..|..|.:.|::.|.:|||||:|||
Human   120 TALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGD 184

  Fly   151 TSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTFNSILITRSYQQLRQI 215
            |||:.|::.|||:|.||:|...||:..|..||:.|:|||||:|||||..||.:|..|||:|||..
Human   185 TSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRAT 249

  Fly   216 FLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCCKSKIDYFSERLHDSMAGMGTKDKTLIRIIV 280
            |..|:.|.|.|||:||:.|.||.::|.:|.:|:|.:...|||:|||:.||.|.||.::|||||:|
Human   250 FQAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVV 314

  Fly   281 SRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAIV 322
            :|:|:||..||..||.||.|||...::.|||||:::.|:|::
Human   315 TRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB9NP_001262796.1 Annexin 26..90 CDD:395139 33/63 (52%)
Annexin 97..162 CDD:395139 32/64 (50%)
Annexin 188..246 CDD:395139 32/57 (56%)
Annexin 256..321 CDD:395139 35/64 (55%)
ANXA13NP_001003954.1 Annexin 59..124 CDD:278615 33/64 (52%)
Annexin 131..196 CDD:278615 32/64 (50%)
Annexin 214..280 CDD:278615 36/65 (55%)
Annexin 290..355 CDD:278615 35/64 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141915
Domainoid 1 1.000 79 1.000 Domainoid score I8766
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100522
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.