DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB9 and ANXA10

DIOPT Version :9

Sequence 1:NP_001262796.1 Gene:AnxB9 / 42492 FlyBaseID:FBgn0000083 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011529873.1 Gene:ANXA10 / 11199 HGNCID:534 Length:344 Species:Homo sapiens


Alignment Length:328 Identity:127/328 - (38%)
Similarity:196/328 - (59%) Gaps:21/328 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGK--------- 69
            |::||..|:|:.||.:|..|::||..|:..:|.||.:|...||:.||||:::.||:         
Human    10 TIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRAQCVLFSSM 74

  Fly    70 -----------DLISDLKSELGGKFEDVILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTL 123
                       |||.|::.:|...|:||:..||.|.|.:.|.||..|:.|:||||..:||||.:.
Human    75 CPCVLIIQLLLDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASR 139

  Fly   124 SNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDA 188
            :|..|..:.:.|...:..:|:.|:..:|||||:...::||||.|:|.. .|.|.|..||..|.:|
Human   140 TNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGY-TDPAMAAQDAMVLWEA 203

  Fly   189 GEGQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCCKSK 253
            .:.:.|..::....||..:||||||.:|.|::|:||.|:..||...:.|..::..:|||.|.:.|
Human   204 CQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDK 268

  Fly   254 IDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRAL 318
            ..||:.||:.::...|..:||:|||:::||||||..|::.::.:|||||...|:...||.||:||
Human   269 PAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHDIRNFASGHYKKAL 333

  Fly   319 LAI 321
            |||
Human   334 LAI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB9NP_001262796.1 Annexin 26..90 CDD:395139 27/83 (33%)
Annexin 97..162 CDD:395139 23/64 (36%)
Annexin 188..246 CDD:395139 19/57 (33%)
Annexin 256..321 CDD:395139 30/64 (47%)
ANXA10XP_011529873.1 Annexin 22..>65 CDD:278615 18/42 (43%)
Annexin 113..178 CDD:278615 23/64 (36%)
Annexin 195..261 CDD:278615 22/65 (34%)
Annexin 271..336 CDD:278615 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.