DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cortactin and dbnla

DIOPT Version :9

Sequence 1:NP_001247222.1 Gene:Cortactin / 42491 FlyBaseID:FBgn0025865 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001002201.1 Gene:dbnla / 431748 ZFINID:ZDB-GENE-040704-42 Length:496 Species:Danio rerio


Alignment Length:488 Identity:135/488 - (27%)
Similarity:198/488 - (40%) Gaps:136/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQS-DRVDKSAVGWDHIEKVEKHESQK 190
            ||::.||...|   .||.      |..::..|.......:| |.|:.:|:    :|||       
Zfish    86 GVKDLRKGVCA---RHVH------SMANFLRGAHVTINARSDDDVEPAAI----MEKV------- 130

  Fly   191 DYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDHKVKPV--IEGAKPSNLRAKFENLAKN 253
              :||.|..:.:..:....     :|.|.|.:..| |..||..:  |:|....|..|:.|...||
Zfish   131 --AKGSGVNYNIHRESSQN-----NHSEPPGRVGS-VYKKVSALDEIQGTSRDNFWAQAERDEKN 187

  Fly   254 SEEESRKRAEEQKRLREAKDKRDRE--EA--------------------AKKTVAENTPRTSTEA 296
            ..:|.|::|:|: |.|..|::||:|  ||                    .||..|||     .|.
Zfish   188 RRQEERRKADEE-RQRLEKERRDQESREAEERERRRKEREKEIDQQRIFEKKLEAEN-----KEE 246

  Fly   297 PPPKGSRAAIQTGRTGGI--GNAISAFNQMQSPVSETPPARKEPIIIPKAQPVKIELEAKEEPTA 359
            ...|..:...||....||  ..::...|:..|.:|:....       |:...:|.|.....:.|:
Zfish   247 EQRKLEKEQQQTPVKAGILRSASVQKANEAASIISQRSTN-------PRELFMKKERSLVNDATS 304

  Fly   360 STTSAAVAPTPTVVPAREPETAPVAKAAAPPPDVVPQIEVETVDTP--PRSEPQSPVYVPTPQPE 422
            |.:|           :|:.:...            |.:..:.|.||  .||:|.||:........
Zfish   305 SPSS-----------SRQGQLRS------------PFLSQQAVSTPSESRSQPLSPLQPVASVSH 346

  Fly   423 VHAQV----QVQPEPQPQADPEPVVEEEPLYQNQAE----------IKAASPLP----------- 462
            |.|:|    :.|..|...|||   ..::|....|||          .:.:||..           
Zfish   347 VPAKVSPVRETQTFPVKTADP---FSDDPFVSEQAEDYDDEWDDSDAEVSSPAATHKQNADGNST 408

  Fly   463 ----PTNGTVSEAVAPSGTATVPEEAIYANSDNLADYLEDTGIHAIALYDYQAADDDEISFDPDD 523
                |:|.::.|.|.....:...||   .|.||       ..|.|.|||||||:||.||||||||
Zfish   409 YMNIPSNQSLYENVHQDFQSPADEE---ENGDN-------QNICARALYDYQASDDTEISFDPDD 463

  Fly   524 VITHIEKIDDGWWRGLCKN-RYGLFPANYVQVV 555
            ||:.|:.||:|||||...: .||:||||||:::
Zfish   464 VISGIDMIDEGWWRGYGPDGHYGMFPANYVELM 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CortactinNP_001247222.1 HS1_rep 84..119 CDD:396686
HS1_rep 121..156 CDD:396686 8/28 (29%)
HS1_rep 158..193 CDD:396686 8/35 (23%)
HS1_rep 195..229 CDD:396686 7/33 (21%)
rne <327..489 CDD:236766 37/192 (19%)
SH3_Cortactin 502..554 CDD:212892 36/52 (69%)
dbnlaNP_001002201.1 ADF_drebrin_like 3..135 CDD:200437 18/70 (26%)
Cgr1 <180..>205 CDD:281823 9/25 (36%)
SH3_Abp1_eu 442..495 CDD:212893 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.