DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7079 and CG16820

DIOPT Version :10

Sequence 1:NP_650936.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:240 Identity:48/240 - (20%)
Similarity:84/240 - (35%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LVESANALLRDF-PK----GIPEVDLKPFNVLSVRDWL-------LVNDSQVGGAWYYFNLINQI 89
            |.|....|::.| ||    |:||     ||:.|:..:.       ..||...||.     ||..:
  Fly    95 LNECIRGLIQSFAPKLRYQGVPE-----FNMDSIDPYFYKRGIFRYTNDGIQGGL-----LIKNM 149

  Fly    90 N-YGFENTTITEI------RGFDKDPTTTKIEIHGKIPRLVYKGDY-----------VAKGRMLW 136
            . ||.....:..:      .||       .|::..::|:|...|.:           |.||....
  Fly   150 EIYGISQLQVNSVAANFTDNGF-------IIKLGVELPQLKAGGHFKADVKFGGLRLVPKGPFNI 207

  Fly   137 FVDIHSQGTSESDFLNFQFVLTLKVRVE-YRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDNEDL 200
            .:|            |.:..:.....:| ..:.::.|.::.|..|:.:....:..:..|.| .:|
  Fly   208 TID------------NIKATILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSD-RNL 259

  Fly   201 TIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYD 245
            ...:.||.|.|..|......|.....:..:.::...:.|.|||.:
  Fly   260 NAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7079NP_650936.1 JHBP 20..249 CDD:214779 48/240 (20%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 48/240 (20%)

Return to query results.
Submit another query.