DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG17189

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 / 43263 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster


Alignment Length:227 Identity:52/227 - (22%)
Similarity:101/227 - (44%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PEDVEKCHFGD---STCLVRSINALIKHYPKGIPEI--GLPPLDAYNFPDSVIMESPSRGPIWMD 83
            |..:|.|...:   :.|..|||.|.:....||:|||  ...|:|... .:.::.:..:.....:.
  Fly    27 PSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMR-QEQLVFKQDNSDVATLS 90

  Fly    84 FRMRDNVNKGFNNATITHVEGFLYEPNQKQI--VLKVRLPRLVHEATYDMSGRVLLFFFNTTGRL 146
            ..:.|.:.:||....|..     .:.::|..  :.|:.||::..:..|.|.||:||......|::
  Fly    91 ANLTDMLIRGFGKMLIKE-----SKVSKKDFSWLTKIYLPQMRIDGHYKMVGRILLVPLQGNGKI 150

  Fly   147 ISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLY----KENTDVTIFMNKL 207
            :.:..:..|.:|.|..:..:....:..:.::...:|:.:....||.|:    ||..|.|   |:.
  Fly   151 VMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNLFNGHSKEVEDST---NQF 212

  Fly   208 FNENWVEFWNDLQPGLVKAFTNAFTVLLNRVF 239
            ||:||.:.:..|:|.:|:........||::.|
  Fly   213 FNDNWKDVFEALRPLVVETVERTLLDLLHKTF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 52/227 (23%)
CG17189NP_001356927.1 JHBP 24..254 CDD:214779 52/227 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.