DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG14259

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:241 Identity:56/241 - (23%)
Similarity:105/241 - (43%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PEDVEKCHF---GDSTCLVRSINALIKHYPKGIPEI--GLPPLDAYNFPDSVIMESPSRGPIWMD 83
            |..:..|..   |.:.|...||..|:.....||||:  ...|.|.....| ::.:..:.....:.
  Fly    43 PAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRD-IVFKQDNNEVATIR 106

  Fly    84 FRMRDNVNKGFNNATI----THVEGFLYEPNQKQIVLKVRLPRLVHEATYDMSGRVLLFFFNTTG 144
            ..:.|.|.|||.|..:    ...:.|.::       .|:.||::..:..|:|:||:||...:.:|
  Fly   107 ANLTDLVVKGFANTKVKESRVSKKDFSWQ-------TKIYLPKMRLDGRYEMAGRILLIPLSGSG 164

  Fly   145 RLISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYK-ENTDVTIFMNKLF 208
            ::..:..:..|.|..|..:..:....:..:..:...|:|.:...:||.|:. .:.:|....|:.|
  Fly   165 KIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFF 229

  Fly   209 NENWVEFWNDLQPGLVKAFTNAFTVLLNRVFD----NVAYDDMFLP 250
            ||||.:|:..|:|.:|:...|....:::.||.    |...:|:..|
  Fly   230 NENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFVEDIPTP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 55/238 (23%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470375
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.