DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and to

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to / 43036 FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster


Alignment Length:243 Identity:58/243 - (23%)
Similarity:104/243 - (42%) Gaps:11/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCWCIPVMISGASLPEDVEKCHFGDSTCLVRSINALI-KHYPKGIPEIGLPPLDAYNFPDSVIME 73
            ||..:.|   .|..|||.:.|.:||..|:::..|.|. ::..:|.|.:.|..||.......||.:
  Fly    10 LCLLVSV---DAKFPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVDRMVISQ 71

  Fly    74 SPSRGPIWMDFRMRDNVNKGFNNATITHVEGF---LYEPNQKQIVLKVRLPRLVHEATYDMSGRV 135
            ..|..|:.:.....||:..|..:..|..|:||   |...::.:||.|..  .||  ..|::.|:|
  Fly    72 GESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTF--SLV--GPYNIQGKV 132

  Fly   136 LLFFFNTTGRLISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDV 200
            |:...:.||:......|.|..::.......:|.:.||.:.:|..::..:........|:..:..:
  Fly   133 LILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKAL 197

  Fly   201 TIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 248
            ...||...|||....:.:....:.::|...:..::..||..:.|...|
  Fly   198 GDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFF 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 58/243 (24%)
toNP_001287525.1 JHBP 5..245 CDD:284096 57/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.