DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG17279

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:250 Identity:74/250 - (29%)
Similarity:128/250 - (51%) Gaps:12/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLISLTFLC--WCIPVMISGASLPEDVEKCHFGDSTCLVRSINALIKHYPKGIPEIGLPPLDAYN 65
            |||  .|:|  |..|   |...||.::|||..|||.|:..::..:::.||||:|.|||..||:..
  Fly     2 RLI--VFVCCLWMAP---SLGQLPPEIEKCRAGDSICIAETVTRILRLYPKGLPSIGLVALDSIG 61

  Fly    66 FPDSVIMESPSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIV-LKVRLPRLVHEATY 129
            |.|.|:......|....|.:..:....||.::|:|..:||  :.:..::: |...:|.|....||
  Fly    62 FEDVVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGF--DADLPRVLELSGWIPLLKLNGTY 124

  Fly   130 DMSGRVLLFFFNTTGRLISDFQNFRITLTIKALVEYRND-KRYLKIYNLVPSLDLDRWIIWLDGL 193
            :|.|.:|....:..|:...:.:..|:...::.|.:.|:| |.|..|..:...||:....:.|:.|
  Fly   125 EMRGSLLTMPIHGKGQAKVEIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENL 189

  Fly   194 YKENTDVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMF 248
            : .|.:::..||.:.|..|:|.|::|:.|:..|.......:|.||.:.:.|||::
  Fly   190 F-NNPEMSDAMNVVANTKWLEIWHNLRRGITSAVDQLVESILQRVANKLPYDDLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 71/243 (29%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26928
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.