DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG7079

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:251 Identity:113/251 - (45%)
Similarity:158/251 - (62%) Gaps:6/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLCW-CIPVMISGA----SLPEDVEKCHFGDSTCLVRSINALIKHYPKGIPEIGLPPLDAYNFPD 68
            ||.: .|.:.:.|.    .||..|:||||||..|||.|.|||::.:||||||:.|.|.:..:..|
  Fly     3 FLAYVIITIQLFGGLQCQKLPAKVKKCHFGDGKCLVESANALLRDFPKGIPEVDLKPFNVLSVRD 67

  Fly    69 SVIMESPSRGPIWMDFRMRDNVNKGFNNATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDMSG 133
            .:::.....|..|..|.:.:.:|.||.|.|||.:.||..:|...:|.:..::||||::..|...|
  Fly    68 WLLVNDSQVGGAWYYFNLINQINYGFENTTITEIRGFDKDPTTTKIEIHGKIPRLVYKGDYVAKG 132

  Fly   134 RVLLFF-FNTTGRLISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKEN 197
            |:|.|. .::.|...|||.||:..||:|..|||||:|||||||.|||::.|||||:|||..:.:|
  Fly   133 RMLWFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFFPDN 197

  Fly   198 TDVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMFLPYVD 253
            .|:||.:|.|||.|||||||:|:||:::.|...|..|...:|:.|.|||:||...|
  Fly   198 EDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFLAAED 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 110/245 (45%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 106/228 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.