DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG1124

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:252 Identity:63/252 - (25%)
Similarity:108/252 - (42%) Gaps:22/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CIPVMISG-----ASLPEDVEKCHFGDS---TCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDS 69
            |:.::|..     |..|..:::||..|.   .|.:.:|..|..:...|||:|.||.::.:.. |:
  Fly     6 CLVIVIQALRMVQAETPPYIKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKM-DT 69

  Fly    70 VIMESPSRGPIWMDFRMRDNVNKGFNNATITHV---EGFLYEPNQKQIVLKVRLPRLVHEATYDM 131
            :.::. :.||......:::....|.:|..:|.:   ||  .||.:.:||    :|:|..||.|..
  Fly    70 LALQL-TEGPQGYKITLKNMEAFGASNFKVTSLKLSEG--SEPFKAKIV----MPKLKIEAKYTS 127

  Fly   132 SGRVLLFFFNTTGRLISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKE 196
            ||.:|:...:..|...::|:.....||.|..:.......||.|..|...||:....:.:.|.:..
  Fly   128 SGVLLILPASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSISGAFNN 192

  Fly   197 NTDVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMFLPYVD 253
            |..:....|....||.......:|..|.|...:.|..|.|::..||..:..   |||
  Fly   193 NRILLEATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQF---YVD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 60/246 (24%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.