DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG33680

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:220 Identity:44/220 - (20%)
Similarity:83/220 - (37%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CLVRS---INALIKH--YPKGIPEIGLPPLDAYNFPDSVIMESPSR-GPIWMDFRMRDNVNKGFN 95
            |::.:   |..|:.|  ...|.|...|.||..    |::.::..|: ..::.|.    ..|.|  
  Fly    48 CIINAAYQIRPLLVHGNLGDGFPTSPLEPLSL----DNIELKLSSQFQAVFKDL----EANGG-- 102

  Fly    96 NATITHVEGFLYEPNQKQIVLKVRLPRLVHEATYDMSGRVLLFFFNTTGRLISDFQNFRITLTIK 160
            |.|           .:..:.|.:.||        |:.|:         |.:....:|.:..:.|:
  Fly   103 NYT-----------GKYSLHLNLLLP--------DIKGK---------GNMQGYCENAKAFVKIR 139

  Fly   161 ALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDVTIFMNKLFNENWVEFWNDLQPGLVK 225
            .....||.|.|:|...:...:|...:.:.|..|:..:..:....|.|.|.|...:..|:.|.|..
  Fly   140 GSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKDIAPSLEH 204

  Fly   226 AFTNAFTVLLNRVFDNVAYDDMFLP 250
            ..:..|..:.:::..:..:|:||.|
  Fly   205 GLSKHFLDVADKILASATFDEMFPP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 42/217 (19%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 42/217 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.