DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG5945

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:257 Identity:47/257 - (18%)
Similarity:93/257 - (36%) Gaps:83/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASLPE-DVEKCHFGDSTCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDSVIMESPSRGPIWMDF 84
            |.||: ..|:...|:  |:.:..|.|......|.||:.:.|.:                |:.:: 
  Fly    26 ADLPKCSTEEDQLGE--CVKQLFNTLTPRLKDGNPELRIEPYE----------------PLHLN- 71

  Fly    85 RMRDNVNKGFNNATITHVEGFLY---EPNQKQIVLKV-----------RLPRLVHEATYDMSGRV 135
            |.....:.|..|..||.....:|   ....|::.:|:           ::|:|            
  Fly    72 RTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQMPKL------------ 124

  Fly   136 LLFFFNTTGRLISDFQ----------NFRIT-LTIKAL------VEYRNDKRYLKIYNLVPSLDL 183
                 |..|...:|.|          .|.:| |.::|:      |..::..|:.::.|:.....:
  Fly   125 -----NIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKI 184

  Fly   184 DRWIIWLDGLYKENTDVTIFMNKLFNENW-----------VEFWNDLQPGLVKAFTNAFTVL 234
            ...:|..:|::.:.....|.:| :.|:.|           .:||   ||.:::.|..||.::
  Fly   185 KDLVIKANGIFADPELDKIALN-VANQYWRDIYGIMLPETRQFW---QPLMLRMFNEAFELV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 47/257 (18%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 47/257 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.