DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31189 and CG3246

DIOPT Version :9

Sequence 1:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:283 Identity:45/283 - (15%)
Similarity:103/283 - (36%) Gaps:84/283 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASLPEDVEKCHFGDSTCLVRSINALIKHY----PKGIPEIGLP-PLDAYNFPDSVIMESPSRGPI 80
            ||..:|..|.....:: :...:.|::.|:    |:|:|.:.:| ||:..|...|:          
  Fly    33 ASESDDALKIKESQAS-IAAQVEAMLVHFQQEDPQGLPGVPVPDPLEVPNVKKSM---------- 86

  Fly    81 WMDFRMRDNVNKGFNNATITHVEGF---LYEPNQKQIVLK-------VRLPRLVHEATYDMSGRV 135
                        |..|..:..|:.:   .:..::..:.||       ::|.:::.:..|.:|.  
  Fly    87 ------------GMANLDMKQVKAYGLSKFRIDKMNLDLKEMRFNGGLQLDQMLVKGQYTLSS-- 137

  Fly   136 LLFFFNTT------------------------GRLISDFQNFRITLTIKAL-VEYRN----DKRY 171
               ||:..                        |:|.:|  ..:|.:|...: ::::|    ...:
  Fly   138 ---FFSKANGPFTVVLKNVYAEATAFLAVERDGQLATD--RIKIDITFSDMTMDFQNLGLVGSVF 197

  Fly   172 LKIYNLVPSLDLD--RWIIWLDGLYKENTDVTIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVL 234
            ..:.|..|:|..|  :..:..:...|..:::.:.:.|...|..:.  |.:.|      .::...:
  Fly   198 QSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTLGERRLP--NSITP------LDSAIAM 254

  Fly   235 LNRVFDNVAYDDMFLPYVDIRMG 257
            ..::.....:|...||.|:..||
  Fly   255 ARKMVRQKGFDPYHLPDVNRTMG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31189NP_732580.3 JHBP 9..249 CDD:284096 40/273 (15%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 38/244 (16%)
Grp7_allergen 260..418 CDD:293589 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.