DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and ARHGAP25

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_016860912.1 Gene:ARHGAP25 / 9938 HGNCID:28951 Length:650 Species:Homo sapiens


Alignment Length:489 Identity:110/489 - (22%)
Similarity:186/489 - (38%) Gaps:126/489 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 IPLVVRDCIDFLQDHLKCEQ-IYKIEPIKTRLMHFKRLYNNREHDSAVDELNLPTACSLLKLFLR 269
            :|::|..|.:|:.:|.:.|: |:::......:...:..::..|..|...:.::.|..|||||:||
Human   181 VPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLR 245

  Fly   270 ELPEPLLTTDLVARF---EEVASHPKVTTQQAELQQLLEQLPKCNRTLLAWVLLHFDAVIQQERH 331
            :||||::.......|   .::.:..:...|| ||.:.|..||:.|.:||:::......:......
Human   246 DLPEPVVPWSQYEGFLLCGQLTNADEAKAQQ-ELMKQLSILPRDNYSLLSYICRFLHEIQLNCAV 309

  Fly   332 NKLNAQSLAMLLSPTLQMS---------------HRLMVALLCHCNNLFADVQLIKYVPPLTSTS 381
            ||::..:||.::...|..|               .|:|..::.....||...:.|...||.....
Human   310 NKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKND 374

  Fly   382 PKLP---------DTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREEQL--------------- 422
            ||..         |..||::  :.:.|| .|.:.|:.:....|.::....               
Human   375 PKKAPVARSSVGWDATEDLR--ISRTDS-FSSMTSDSDTTSPTGQQPSDAFPEDSSKVPREKPGD 436

  Fly   423 WEVQ---RIITQLKRK---LRTFEKKQEKTAEEVDNSSSAPPAVA----------SED------- 464
            |::|   |..|...||   ...|:.......|...|...:|.:.|          |:|       
Human   437 WKMQSRKRTQTLPNRKCFLTSAFQGANSSKMEIFKNEFWSPSSEAKAGEGHRRTMSQDLRQLSDS 501

  Fly   465 ----TTDSKPA--GTPAVSTNNSISQE-EPKTDTLTPKDAPNDFTIDPSTGFILLPKSNPHRENL 522
                |.|:.|:  |:|....:...||. :.|.|||.   :||..| .|.       |.|...|  
Human   502 QRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLA---SPNSET-GPG-------KKNSGEE-- 553

  Fly   523 LRLQIEYDELMEWQNELKARIVAERNEVYRLKQLYEQQSINSQMASLASGSQAPPESDYERIIEH 587
                 |.|.|.....||       |.|:...||:||:|                        |::
Human   554 -----EIDSLQRMVQEL-------RKEIETQKQMYEEQ------------------------IKN 582

  Fly   588 YTRENALLEHKKNMLGMELKEERRACIALQVELR 621
            ..:||..:..|...|..||::|::...||::.||
Human   583 LEKENYDVWAKVVRLNEELEKEKKKSAALEISLR 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 42/180 (23%)
ARHGAP25XP_016860912.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.