DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and AGD2

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_176283.1 Gene:AGD2 / 842378 AraportID:AT1G60860 Length:776 Species:Arabidopsis thaliana


Alignment Length:715 Identity:138/715 - (19%)
Similarity:226/715 - (31%) Gaps:259/715 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFDSPEEKEFPGLYASEAADAKSRKSKEESDFSEDHDHSKKDLLIGRRKDKKEKGKDRGYAALE 65
            |..|..|.||             ||:..:::..|.|.         .|.|....|...||....|
plant   112 MTVDLQEAKE-------------SRRRFDKAVHSYDQ---------AREKFVSLKKNTRGDIVAE 154

  Fly    66 GESSPEEELDTKSPSKSKKSKTFKFTSS----KSKEKREKSRDKSEKDSKH-----------AEE 115
                .||:|: .|.|..:||: |...:|    ::|:|.|.....|.....|           ::.
plant   155 ----LEEDLE-NSKSAFEKSR-FNLVNSLMTIEAKKKYEFLESISAIMDSHFKYFKLGYDLLSQL 213

  Fly   116 EPSVSHKV-----KEKERDK-EKDRDEPK----KKDKEEKRKEKDKKADKKD-----------KK 159
            ||.: |:|     :.||:.| |:||...:    :...|...::...|||..|           :|
plant   214 EPYI-HQVLTYAQQSKEQSKIEQDRFAQRIQEFRTQSELDSQQASAKADPSDVGGNHVYRAIPRK 277

  Fly   160 DKKSKQLSQQQDDVSAAEEVLALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQDHLKCE 224
            :.::..:|      :|.:||...|| :...|.||..:..|..              |:.|:....
plant   278 NVEANSVS------TADKEVTKQGY-LLKRSASLRADWKRRF--------------FVLDNHGSL 321

  Fly   225 QIYKIEPIKT-RLMH---------------FKRLYNNREHDSAVDELNLPTACSLLKLFLRELPE 273
            ..|:....|: :..|               |:..:|......::|...:....||:||...:   
plant   322 YYYRNTGNKSAKSQHYYSGLGEHSSGVFGRFRTRHNRSASQGSLDCNMIDLRTSLIKLDAED--- 383

  Fly   274 PLLTTDLVARFEEVASHPKVTTQQAELQQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQS 338
                |||...| .:.|..|..|.|||          .....:.||             ||:.|  
plant   384 ----TDLRLCF-RIISPQKTYTLQAE----------NGADRMDWV-------------NKITA-- 418

  Fly   339 LAMLLSPTLQMSHRLMVALLCHCNNLFADVQLIKYVPPL-TSTSPKLP----DTPEDIQTELRKQ 398
                             |:....|:.|......:|:... ||:.|...    :..||....|...
plant   419 -----------------AITIRLNSHFLQQSPARYLDKKNTSSGPATENLTLNQKEDYNQRLNVG 466

  Fly   399 DSLLSQIH------------------SEMNAG----------------FITKKR----EEQLWEV 425
            |.:|:.:.                  :.:|.|                .|:|.|    :.::|| 
plant   467 DDVLTILREIPGNNTCAECNAPDPDWASLNLGVLMCIECSGVHRNLGVHISKVRSLTLDVKVWE- 530

  Fly   426 QRIITQLKRKLRT--FEKKQEKTAEEVDNSSSAPPAVASEDTTDSKPAGTPAVSTNNSISQEEPK 488
             ..|..|.|.|..  .....|:....:|:.|                              |:..
plant   531 -PTILDLFRNLGNGYCNSVWEELLHHLDDDS------------------------------EKGS 564

  Fly   489 TDTLTPKDAPNDFTIDPSTGFILLPKSNPHRENLLRLQIEYDELMEWQNELKARI---VAERN-- 548
            ||||.....|:      |..:..|.:...:.:.|.:..:..|| .|..:...:||   |..||  
plant   565 TDTLASVSKPS------SEDWFTLKEKYINGKYLEKALVVKDE-REANSTASSRIWEAVQSRNIR 622

  Fly   549 EVYRLKQLYEQQSINSQMASLASGSQAPPESDYERIIEHYTRENALLEHKKNMLGMELKEERRAC 613
            ::|||....:...||::...:         :|.:  :.|:...:|..|.||       :.:..||
plant   623 DIYRLIVKADANIINTKFDDI---------TDLD--VYHHHHVDAPDEVKK-------RHDPNAC 669

  Fly   614  613
            plant   670  669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 34/196 (17%)
AGD2NP_176283.1 BAR_SFC_plant 15..216 CDD:153290 30/131 (23%)
PH 291..420 CDD:278594 34/193 (18%)
PH_ACAP 293..425 CDD:270070 34/196 (17%)
ArfGap 470..604 CDD:214518 26/172 (15%)
ANK repeat 676..714 CDD:293786
ANK <684..763 CDD:238125
Ank_4 686..737 CDD:290365
ANK repeat 716..747 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.