DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and Gmip

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_030099716.1 Gene:Gmip / 78816 MGIID:1926066 Length:1002 Species:Mus musculus


Alignment Length:435 Identity:95/435 - (21%)
Similarity:157/435 - (36%) Gaps:119/435 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLMHFKRLYNNREHDSAVDEL--NLP-TACSLLK 265
            ::|.|:..|...::.. |..:.||::...:.|:   :||....|:..|:.||  |.| ...|:||
Mouse   574 EVPFVITRCTAEIEHRALGLQGIYRVSGSRVRV---ERLCQAFENGRALVELSGNSPHDITSVLK 635

  Fly   266 LFLRELPEPLLTTDLVARFEEVA--------SHPKVTTQQAE----LQQLLEQLPKCNRTLLAWV 318
            .||:||.:|::...|...|..:|        ..|.......|    |:.||.|||..|.:.|..:
Mouse   636 RFLQELTDPVVPFHLYDAFISLAKTLHADPGDDPGTPNPSPEIIRSLKTLLVQLPDSNYSTLRHL 700

  Fly   319 LLHFDAVIQQERHNKLNAQSLAMLLSPT-------------------LQMSH--RLMVALLCHCN 362
            :.|...|..:...||::|.:|.::..||                   |...|  :|:..|:.|..
Mouse   701 VAHLFRVAARFEENKMSANNLGIVFGPTLLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYE 765

  Fly   363 NLFADVQLIKYVPPLTSTSPKLPDTPEDIQTELRKQDSLLSQ----------------IHSEMNA 411
            .:|...:|.....|||. .|.|  .|..:::..:...|||:|                .||.:  
Mouse   766 QIFGMDELPLASEPLTQ-DPGL--APACLESSPQHPASLLAQDTQPLTIALDSSPDPKHHSAL-- 825

  Fly   412 GFITKKREEQLWEVQRIITQLKR-------------KLRTFEKKQEKTAEEV--------DNSSS 455
                    |:..||......|.|             :|.|.::.|.:  |||        |.||.
Mouse   826 --------EKCPEVTPPEKSLNRDFAIGSHVLGFFLQLATLQRDQRE--EEVEDTRDGAGDGSSH 880

  Fly   456 APPAVA---------SEDTTDSKPAGTPAVS--------TNNSISQEEPKTDTLTPKDAPNDFTI 503
            .|..:|         |.........|...|:        ..:.:.:|.|.|.:...:.:.....:
Mouse   881 CPEDLALGAQSRGHFSRQPVKYSRGGVRPVTHQLSSLALVASKLCEETPVTVSAVHRGSLRVRGL 945

  Fly   504 DPSTGFILLPKSNPHRENLLRLQIEYDELMEWQNELKARIVAERN 548
            .|:..   .|:.:|.|.|.|....|.       .:..||::::.|
Mouse   946 GPAAA---CPEGSPLRRNPLPKHFEI-------TQETARLLSKLN 980

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 50/199 (25%)
GmipXP_030099716.1 BAR 124..324 CDD:386243
C1 503..548 CDD:197519
RhoGAP 560..763 CDD:383032 48/191 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.