DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and Arhgap15

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_722542.2 Gene:Arhgap15 / 76117 MGIID:1923367 Length:481 Species:Mus musculus


Alignment Length:254 Identity:60/254 - (23%)
Similarity:108/254 - (42%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 KKKDKEEKRKE-----KDKKADKKDKKDKKS--KQLSQQQDDVSAAEEVLALGYPVFGVSVSLAT 195
            :|:.|.|.||.     ....:|..||...||  |:...::..:...:|...:...:||..:....
Mouse   229 RKEQKPEHRKSFMFRLHHSASDTSDKNRVKSRLKKFISRRPSLKTLQEKGLIKDQIFGSHLHTVC 293

  Fly   196 ERSRCHDGVDIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLMHFKRLYNNRE----HDSAVDEL 255
            ||...    .:|..|:.||:.::.. |..:.||::......:...:.:.|..|    .||..:::
Mouse   294 EREHS----TVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDI 354

  Fly   256 NLPTACSLLKLFLRELPEPLLTTDLVARFEEVA----SHPKVTTQQAELQQLLEQLPKCNRTLLA 316
            ::.|..  ||:|.|||.|||.......||.|..    |:.|:.|    ::.|:::||..|...:.
Mouse   355 HVVTGA--LKMFFRELSEPLFPYSFFERFVEAIKKQDSNEKIET----MRSLVKRLPPPNHDTMK 413

  Fly   317 WVLLHFDAVIQQERHNKLNAQSLAMLLSPTLQMSHRLMVALLCHC--NNLFADVQLIKY 373
            .:..|...::.:...|.::.|||.::..|||..:......:..|.  .|..|:..|.:|
Mouse   414 ILFRHLTKIVAKASQNLMSTQSLGIVFGPTLLRAENESGNVAVHMVYQNQIAEFMLTEY 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 46/191 (24%)
Arhgap15NP_722542.2 PH 88..196 CDD:278594
PH_ARHGAP9-like 89..198 CDD:270053
RhoGAP_ARHGAP27_15_12_9 285..471 CDD:239868 47/195 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.