DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and arhgap35b

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_003198691.2 Gene:arhgap35b / 564565 ZFINID:ZDB-GENE-060526-44 Length:1517 Species:Danio rerio


Alignment Length:372 Identity:86/372 - (23%)
Similarity:155/372 - (41%) Gaps:77/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFDSPEEKEFPGLYASEAADA--KSRKSKEESDFSEDHDHSKKDLLIGRRKDKKEKGKDRGYAAL 64
            |:|       |..|| |..||  |.|.|.|:|.:|..||.::..::..|..::.........:..
Zfish  1099 DYD-------PSDYA-EPMDAVSKPRPSYEDSIYSVPHDSTQGKIITIRNSNRIHSNGGGNGSDS 1155

  Fly    65 EGESSPEEELDTKSPSKSKKSKTFKFTSSKSKEKREKSRDKSEKDSKHAEEEPSVS----HKVKE 125
            ||:.|..|             :..||::::.|.:  ..||:|::..|.:....|.|    .::..
Zfish  1156 EGDGSSLE-------------RRRKFSAARVKPR--LYRDRSKRLGKFSSFRTSFSIGSDDEIGT 1205

  Fly   126 KERDKEKD------------RDEPKKKDKEEKRKEKDKKADKKDKKDKKSKQLSQQQDDVSAAEE 178
            ..|.||.|            .::|||::..:..:...|||..|.:            ..:|...|
Zfish  1206 LSRSKEDDVSPLKTDITNEEGEDPKKRNILKSLRRPGKKARPKPR------------HSISKPLE 1258

  Fly   179 VLALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQ-DHLKCEQIYKIEPIKTRLMHFKRL 242
            ....|.|:..|   ::.||       .||:.:..||.::: ..|..|.||::...|..:...:|.
Zfish  1259 SNYFGVPLVNV---VSFER-------PIPVFIDKCIRYIEATGLTTEGIYRVSGNKAEIEGMQRQ 1313

  Fly   243 YNNREHDSAVD----ELNLPTACSLLKLFLRELPEPLLTTDLVARFEEVASHPKVTTQQAEL--- 300
            :   |.|..:|    :..:.|....:|.|..|||:||:.   .:..||:....|:..::..|   
Zfish  1314 F---EQDHNLDFVEKDFTVNTVAGAMKSFFSELPDPLVP---YSSQEELVEAFKINDREQRLHTM 1372

  Fly   301 QQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTL 347
            :.:|.:.|:.|..:..:|:.|.:.|.|..|.|.:.:::|::...|||
Zfish  1373 KDVLRRFPRENFDVFKYVMSHLNKVGQWNRVNLMTSENLSICFWPTL 1419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 41/169 (24%)
arhgap35bXP_003198691.2 Ras_like_GTPase 29..245 CDD:206648
Ras <158..247 CDD:331851
RhoGAP-FF1 261..340 CDD:318668
FF 431..483 CDD:128718
RhoGAP_p190 1262..1446 CDD:239838 43/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.