DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and Arhgap40

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001138487.1 Gene:Arhgap40 / 545481 MGIID:3649852 Length:672 Species:Mus musculus


Alignment Length:394 Identity:88/394 - (22%)
Similarity:147/394 - (37%) Gaps:98/394 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 VFGVSV-SLATERSRCHDGVDIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLMHFKRLYNNREH 248
            :|||.: ||.....|......:||:::..:..|:.. |..|.|.::...:.|:   |.|....|.
Mouse   318 LFGVPLHSLLEADHRVFPSTQVPLLLQALLSCLEKRGLDTEGILRVPGSQARV---KGLEQKLER 379

  Fly   249 D-----SAVDELNLPTACSLLKLFLRELPEPLLTTDLVARFEEVASHPKVTTQQAELQQLLEQLP 308
            |     .:.|:::...|..|||.|||:||.||||.:.:..|..|...|.:..:...|..|:..||
Mouse   380 DFYAGLVSWDKVHPNDASDLLKRFLRKLPVPLLTAEYLPAFASVPDIPDLKQRLQALHLLVLLLP 444

  Fly   309 KCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTLQMSHRLMVALLCHCNNLFADVQLIKY 373
            :.||..|..:|.....|..||:|||:...:::.::.|:|                         :
Mouse   445 EPNRNTLKALLEFLRKVAAQEQHNKMTLWNVSTVMVPSL-------------------------F 484

  Fly   374 VPPLTSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREEQLWEVQRIITQLKRKLRT 438
            :|  ....|||        |:..||   |::..:|:....:  :.::.||.|...:....|||..
Mouse   485 LP--RGRPPKL--------TKGGKQ---LAEGAAEVVCMMV--QYQDLLWTVASFLVAQVRKLND 534

  Fly   439 FEKKQEKTAE----------EVDNSSS-----APPAVA---------SED--------------- 464
            ...::.:..:          .||...:     |.|.||         |.|               
Mouse   535 SNGRRSQLCDGGLKTWLWRTHVDRDKAGEGLEATPKVAKIQVQATWPSMDLLQVPLNPSTRVTHV 599

  Fly   465 ----TTDSKPAGTPAVSTN--NSISQEEPKTDTLTPKDAPNDF---TIDPSTGFILLPKSNPHRE 520
                |....|...|...:.  ||:.....|..|....:...:.   .:||....:.|.::|||.|
Mouse   600 LKLFTEHLNPGSQPEEGSENPNSLLSHNTKPVTFLVYEVGGNIGERRLDPDAYLLDLYRANPHGE 664

  Fly   521 NLLR 524
            .::|
Mouse   665 WVIR 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 50/187 (27%)
Arhgap40NP_001138487.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..68
RhoGAP 318..530 CDD:295372 62/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1372
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.