DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and OPHN1

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_002538.1 Gene:OPHN1 / 4983 HGNCID:8148 Length:802 Species:Homo sapiens


Alignment Length:612 Identity:112/612 - (18%)
Similarity:206/612 - (33%) Gaps:185/612 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HSKKDLLI--------------GRRKDKKEKGKDRGYAALEGESSPEEELDTKSPSKSKKSKTFK 89
            |:..||||              ..||.|.||..:|.|:.|:                     ...
Human   106 HNASDLLIKPLENFRKEQIGFTKERKKKFEKDGERFYSLLD---------------------RHL 149

  Fly    90 FTSSKSKEKREKSRDKSEKDSKHAEEEPSVS--HKVKEKERDKEKDRDEP--------------- 137
            ..|||.||.:.:..|......:|...|.|:.  ::::|.:..|:.:..||               
Human   150 HLSSKKKESQLQEADLQVDKERHNFFESSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLT 214

  Fly   138 --------------------------KKKDKEEKRKEKDKKADKKDK------------------ 158
                                      ..:::.|:.|::.|:|.:..|                  
Human   215 VELTQDFLPYKQQLQLSLQNTRNHFSSTREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWA 279

  Fly   159 -----------KDKKSKQLS----QQQDDVSAAEEVLALGYPV------------FGV------- 189
                       .:|::|.|:    :|:.........|.|.|.|            |.:       
Human   280 LGISWVKYYCQYEKETKTLTMTPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPG 344

  Fly   190 -----SVSLATER--SRCHDGVDIPL-------------------VVRDCIDFLQDH-LKCEQIY 227
                 ::|.|..|  ....||.: |:                   .||.||:.::.. :|.|.:|
Human   345 TITLQALSEANRRLWMEAMDGKE-PIYHSPITKQQEMELNEVGFKFVRKCINIIETKGIKTEGLY 408

  Fly   228 KIEPIKTRLMHFKRLYNNREHDSAVD----ELNLPTACSLLKLFLRELPEPLLTTDLVARFEEVA 288
            :......::......:.:.:....||    :.::.|..|.||.:||.|.||::|..|.......|
Human   409 RTVGSNIQVQKLLNAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAA 473

  Fly   289 SHPKVTTQQAELQQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTLQMSHRL 353
            ....:..:...:..|:.:||:.||.:|..::.|...|.:..:.|.:...::.::..|||..:...
Human   474 KSDNLDYRLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQED 538

  Fly   354 MVALLCHC--NNLFADVQLIKYV------PPLTSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMN 410
            .||.:.:.  .|:..:: ||::.      ||..|.:|.:|  |..:.....|..::..::..|..
Human   539 TVAAMMNIKFQNIVVEI-LIEHFGKIYLGPPEESAAPPVP--PPRVTARRHKPITISKRLLRERT 600

  Fly   411 AGFITKKREEQLWEVQR------IITQLK-RKLRTFEKKQEKTAEEVDNSSSAPPAVASEDTTDS 468
            . |.|...:|...|:|.      |.:.:: .|.....|...:.:.|.|....:|    |....|.
Human   601 V-FYTSSLDESEDEIQHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPGRKSP----SRPILDG 660

  Fly   469 KPAGTPAVSTNNSISQEEPKTDTLTPK 495
            |....|.|.....:|:.:.....:|||
Human   661 KLEPCPEVDVGKLVSRLQDGGTKITPK 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 43/220 (20%)
OPHN1NP_002538.1 BAR_OPHN1 19..225 CDD:153317 26/139 (19%)
PH 266..363 CDD:278594 12/96 (13%)
BAR-PH_GRAF_family 267..370 CDD:269953 15/103 (15%)
RhoGAP_Graf 363..559 CDD:239839 41/197 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 569..588 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 607..666 12/62 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 680..770 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 783..802
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.