DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and Appl2

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001102211.1 Gene:Appl2 / 362860 RGDID:1563028 Length:662 Species:Rattus norvegicus


Alignment Length:306 Identity:68/306 - (22%)
Similarity:119/306 - (38%) Gaps:66/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 AVDELNLPTACSLLKLFLRELPEPLLTTDLVARFEEVASHPKVTTQQAELQQLLEQL-------- 307
            |||:|       ||:..|::.|:   |..|::.|||.|.  .:|....:|.|.::::        
  Rat     3 AVDKL-------LLEEALQDSPQ---TRSLLSVFEEDAG--TLTDYTNQLLQAMQRVYGAQNEMC 55

  Fly   308 ---PKCNRTLLAW---------------VLLHFDAVIQQE---RHNKLNAQSLAMLLSPTLQMSH 351
               .:.:|.|||:               ..||:.:.:..|   .|::|..|....::.|.:|...
  Rat    56 LATQQLSRQLLAYEKQNFALGKGDEEVISTLHYFSKVMDELNGLHSELAKQLADTMVLPVIQFRE 120

  Fly   352 RLM--VALLCHCNNLFA------DVQLIKY--VPPLTSTSPKLPDTPEDIQTELRKQDSLLSQIH 406
            :.:  |:.|   .:||.      |:.:.||  :|..........|..:::....|||.....|.:
  Rat   121 KDLTEVSTL---KDLFGLASNEHDLSMAKYSRLPKRKENERVKTDVAKEVAAARRKQHLSSLQYY 182

  Fly   407 SEMNAGFITKKREEQLWEVQRIITQLKRKLRTFEKKQEKTAEEVDN-SSSAPPAVASEDTTDSKP 470
            ..:|| ...:||...:   :.:|.....::..|:|..|..::.:|. .||....|.|........
  Rat   183 CALNA-LQYRKRAAMM---EPLIGFAHGQINFFKKGAEMFSKSMDGFLSSVTDMVQSIQVELEAE 243

  Fly   471 AGTPAVSTNNSISQEE----PKTDTLTPKDAPNDFTIDPSTGFILL 512
            |....||....:|..|    |..|..||:...|   :...||::.|
  Rat   244 ADKMRVSQQELLSVSESVYTPDIDVATPQINRN---LIQKTGYLNL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 33/153 (22%)
Appl2NP_001102211.1 BAR_APPL2 20..234 CDD:153316 44/222 (20%)
BAR-PH_APPL 252..376 CDD:270067 10/38 (26%)
PTB_APPL 480..613 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.