DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and hesx1

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_571424.1 Gene:hesx1 / 30620 ZFINID:ZDB-GENE-990415-130 Length:161 Species:Danio rerio


Alignment Length:137 Identity:29/137 - (21%)
Similarity:43/137 - (31%) Gaps:58/137 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 AGTPAVSTNNSI----------SQEEPKTD---------TLTPKDAPNDF--------------- 501
            |.:|:|.|.:||          ....|.||         .:|..|||.|.               
Zfish     5 ANSPSVFTIDSILGLDRPEQRTCPYRPWTDVKPACQNRRVVTESDAPVDVRENEDGKSFSKSPTD 69

  Fly   502 ----TID------PSTGF----------ILLPKSNPH---RENLL-RLQIEYDELMEWQNELKAR 542
                |::      |.|.|          :....|.|.   ||.|. :||::.|.:..|....:|:
Zfish    70 SYRRTLNWYIGRRPRTAFSSVQIKILESVFQVNSYPGIDIREELAKKLQLDEDRIQIWFQNRRAK 134

  Fly   543 IVAERNE 549
            :.....|
Zfish   135 LKRSHRE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846
hesx1NP_571424.1 Homeobox 83..136 CDD:278475 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.