powered by:
Protein Alignment Rlip and hesx1
DIOPT Version :9
Sequence 1: | NP_650933.2 |
Gene: | Rlip / 42484 |
FlyBaseID: | FBgn0026056 |
Length: | 625 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571424.1 |
Gene: | hesx1 / 30620 |
ZFINID: | ZDB-GENE-990415-130 |
Length: | 161 |
Species: | Danio rerio |
Alignment Length: | 137 |
Identity: | 29/137 - (21%) |
Similarity: | 43/137 - (31%) |
Gaps: | 58/137 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 471 AGTPAVSTNNSI----------SQEEPKTD---------TLTPKDAPNDF--------------- 501
|.:|:|.|.:|| ....|.|| .:|..|||.|.
Zfish 5 ANSPSVFTIDSILGLDRPEQRTCPYRPWTDVKPACQNRRVVTESDAPVDVRENEDGKSFSKSPTD 69
Fly 502 ----TID------PSTGF----------ILLPKSNPH---RENLL-RLQIEYDELMEWQNELKAR 542
|:: |.|.| :....|.|. ||.|. :||::.|.:..|....:|:
Zfish 70 SYRRTLNWYIGRRPRTAFSSVQIKILESVFQVNSYPGIDIREELAKKLQLDEDRIQIWFQNRRAK 134
Fly 543 IVAERNE 549
:.....|
Zfish 135 LKRSHRE 141
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rlip | NP_650933.2 |
RhoGap_RalBP1 |
187..368 |
CDD:239846 |
|
hesx1 | NP_571424.1 |
Homeobox |
83..136 |
CDD:278475 |
13/52 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.