DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and cnt-1

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001369802.1 Gene:cnt-1 / 174848 WormBaseID:WBGene00000565 Length:826 Species:Caenorhabditis elegans


Alignment Length:245 Identity:43/245 - (17%)
Similarity:77/245 - (31%) Gaps:72/245 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 VPPLTSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREEQLWEVQRIITQLKRKLRT 438
            |||....|..:.|:|: .:..:.:.....:::.:.:|         |.|..:..:|...|....|
 Worm    13 VPPKIDCSEAIQDSPK-FRATVAQHAMYFNRLENRLN---------EMLRHITAMIDFSKNYTNT 67

  Fly   439 FEKKQEKTAEEVDNSSSAPPAVASEDTTDSKPAGTPAVSTNNSISQEEPKTDTLTPKDAPNDFTI 503
            |.|......:..|.|.|                |.|..||.                        
 Worm    68 FYKLTVSVNQLCDESFS----------------GNPLASTT------------------------ 92

  Fly   504 DPSTGFILLPKSNPHRENLLRLQIEYDELMEWQNELKARIVAERNEVYRLKQLYE--QQSINSQM 566
                 |..|.::..|..||.|...::..::.: .:|...|..|..:|...:..:|  .||::..:
 Worm    93 -----FQGLSEAYAHTVNLFRTYFDHSNVVTF-TKLSNFIKIELTKVAESRAHFENMSQSMDDAL 151

  Fly   567 ASLASGSQAPPESDYE--------------RIIEHYTRENALLEHKKNML 602
            ...||.|:..|....|              ..:::....|....||.:|:
 Worm   152 VKNASISRQKPADATEGRNALTAVGTCFAHTTLDYVANINIAHAHKDHMI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846
cnt-1NP_001369802.1 BAR_ACAPs 30..233 CDD:153287 37/227 (16%)
PH_ACAP 278..377 CDD:270070
ArfGap_ACAP 447..565 CDD:350064
PTZ00322 628..>795 CDD:140343
ANK repeat 690..721 CDD:293786
Ank_2 695..775 CDD:403870
ANK repeat 723..754 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.