DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and AgaP_AGAP003026

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_311850.4 Gene:AgaP_AGAP003026 / 1272926 VectorBaseID:AGAP003026 Length:465 Species:Anopheles gambiae


Alignment Length:466 Identity:91/466 - (19%)
Similarity:163/466 - (34%) Gaps:122/466 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFDSPEEKEFPGLYASEAADAKSRKSKEESDFSEDHDHSKKDLLIGRRKD-----KKEKGKDRG 60
            :..|:|..|  |.|...:.....:|..||   :....||.:.:.::..:.|     ::..|.|..
Mosquito    20 IQLDAPTPK--PVLCERDDIMGPTRYGKE---YHGTMDHKECEQMLKDKPDGSYLVRRSPGADNY 79

  Fly    61 YAALEGESSPEEELDTKSPSKSKKSKTFKFTSSKSKEKREK------------------------ 101
            |.           |..:....:|..|.| :...|....||.                        
Mosquito    80 YT-----------LSLRFGQATKHFKIF-YCPEKGHYLRENFKKFETVEEMVADGLVDFYMRLHA 132

  Fly   102 ---SRDKSEKDSKHAEEEPSVS-HKVKEKE----------RDKEKDRDEPKKKDKEEKRKEKDKK 152
               .::...:..|..|:.|.:: |:.|.:.          :|..:..|.....|::...|..|::
Mosquito   133 APILKEMMSQTKKCYEQSPYMTLHRRKLRSLCKPSKLPMVQDSLESADTEIADDRDGGAKGADQE 197

  Fly   153 A-DKKDKKDKKSKQLSQQQ------------------------------DD------VSAAEEVL 180
            . :|.|..|....:..:|.                              ||      ...:|.|.
Mosquito   198 QFEKSDTHDNAYPEYEKQHAFKTHTFKGLNWCEFCANFLWGFTSQGVKCDDCGFMAHFKCSELVP 262

  Fly   181 ALGYP-------VFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLM 237
            |...|       :|||.::......:|.    ||.:|:.|::.:::| :..|.||:|......:.
Mosquito   263 AKCVPDLKRLRGIFGVDLTTLVTAHKCR----IPFIVKKCVEEVENHGMLQEGIYRISGFADEIE 323

  Fly   238 HFKRLYN---NREHDSAVDELNLPTACSLLKLFLRELPEPLLTTDLVARFEEVASHPKVTTQQAE 299
            ..|...:   .:...||....|:.....:|||:||.||.||:|......|.|......:..|...
Mosquito   324 ALKMALDKDGEKADVSAQMYSNINVIAGVLKLYLRLLPVPLITFQSFPLFMESMREKSIGEQVIA 388

  Fly   300 LQQLLEQLPKCNRTLLAWVLLHFDAVIQQERHNKLNAQSLAMLLSPTL--------QMSHR--LM 354
            |:..::.||..:...|.::|.|.:.:......||:|..:||.:.:|||        .:|..  ::
Mosquito   389 LRNAVKALPPAHLHCLKYILEHLNRIASHHTINKMNEHNLATVFAPTLIATPQHMTDLSQEISML 453

  Fly   355 VALLCHCNNLF 365
            .||:.||:.:|
Mosquito   454 AALISHCHAIF 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 50/193 (26%)
AgaP_AGAP003026XP_311850.4 SH2 40..130 CDD:301589 16/104 (15%)
C1_1 216..268 CDD:278556 5/51 (10%)
RhoGAP 276..464 CDD:295372 49/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.