DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and AgaP_AGAP000563

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_310516.5 Gene:AgaP_AGAP000563 / 1271660 VectorBaseID:AGAP000563 Length:983 Species:Anopheles gambiae


Alignment Length:407 Identity:89/407 - (21%)
Similarity:131/407 - (32%) Gaps:139/407 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GKDRGYAALEGESSPEEELDTKSPSKSKKSKTFKFTSSKSKEK--REKSRDKSEKDSKHAEEEPS 118
            |...|.||    :.||   |:.:.|.|...|:....|||..||  .:|.|.:|.:........|.
Mosquito   590 GLGSGAAA----AGPE---DSSTSSSSLSFKSLGADSSKFPEKWSIKKLRRRSYRQLLRRTNAPR 647

  Fly   119 VSHK------VKEKERDKEKDR-----------------DEPKKKDKEE-------KRKEKDKKA 153
            ....      |:|:|.::|.|.                 .||.:::.||       ...:....|
Mosquito   648 KGGSGGGGGVVQEQEEEEEGDEAYEQASSRLPVTDLDGDSEPDEEEGEEGEGAGGASGAKSCPDA 712

  Fly   154 DKKDKKDKKSKQ-------------------------LSQQQDDVSAAE----------EVLALG 183
            |:||...:..||                         |:..|:..|..|          |.|:..
Mosquito   713 DEKDVLARVPKQFADILLIGDNILTDDHNLPDEDLLLLNSDQESTSGEEDNAIMECEELERLSPN 777

  Fly   184 Y-----------PVFGVSVSLATERS--RCHDGVDIPL-------VVRDCIDFL---------QD 219
            |           ||...:::|..::|  ..||....||       .|..| :||         .|
Mosquito   778 YLLYKAASGHNLPVMSQALALGADKSWANPHDADRTPLHAAILSGSVMSC-EFLLLNGAAINATD 841

  Fly   220 -------HLKCEQIYKIEPIKTRLMHFKRLYN------NREHDSAVDELNLPTACSLLKLFL--- 268
                   ||..||....:..  .|:..|..|:      .|..|.||::.:.... :||:|.|   
Mosquito   842 RYGRTPLHLAAEQGSAAQAY--LLLKHKARYDIADVDGRRPIDVAVEKEDADIV-TLLRLTLLND 903

  Fly   269 ----RELPEPLLTTD-----LVARFEEVASHPKVTTQQAELQQLLEQLPKCNRTLLAWVLLH--- 321
                .|..|.....|     ::..|..:||:.....|:...||..:|..:..:.|.|....|   
Mosquito   904 EIGSGEDGEAYAGGDSTYVAVMNEFSHLASNQPQRLQRNRHQQQQQQQQQQRQALAATDDSHPLD 968

  Fly   322 FDAVIQQERHNKLNAQS 338
            .||..|.    |.||.|
Mosquito   969 LDATSQA----KSNAVS 981

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 46/198 (23%)
AgaP_AGAP000563XP_310516.5 BAR_3 6..239 CDD:293351
PH 304..397 CDD:278594
PH_ACAP 305..400 CDD:270070
ArfGap 469..585 CDD:279720
ANK 777..896 CDD:238125 25/122 (20%)
Ank_2 780..874 CDD:289560 20/96 (21%)
ANK repeat 780..806 CDD:293786 4/25 (16%)
ANK repeat 812..841 CDD:293786 6/29 (21%)
ANK repeat 843..874 CDD:293786 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.