DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and CHN1

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001358443.1 Gene:CHN1 / 1123 HGNCID:1943 Length:476 Species:Homo sapiens


Alignment Length:164 Identity:52/164 - (31%)
Similarity:81/164 - (49%) Gaps:20/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PLVVRDCIDFLQDH-LKCEQIYK-------IEPIKTRLMHFKRLYNNREHDSAV---DELNLPTA 260
            |:||..||..::.. |..|.:|:       ||.:|   |.|.|  :..:.|.:|   :::|:.|.
Human   299 PMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVK---MAFDR--DGEKADISVNMYEDINIITG 358

  Fly   261 CSLLKLFLRELPEPLLTTDLVARFEEVASHPKVTTQQAELQQLLEQLPKCNRTLLAWVLLHFDAV 325
            .  |||:.|:||.||:|.|...:|.|.|.......|...|.:.|:.||..:...|.:::.|...|
Human   359 A--LKLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRV 421

  Fly   326 IQQERHNKLNAQSLAMLLSPTLQMSHRL--MVAL 357
            ...|:.|.:||::|.::..|||..|..|  |.||
Human   422 TLHEKENLMNAENLGIVFGPTLMRSPELDAMAAL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 52/164 (32%)
CHN1NP_001358443.1 SH2 67..145 CDD:387587
C1_1 223..272 CDD:365894
RhoGAP_chimaerin 283..476 CDD:239837 52/164 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.