DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rlip and si:dkeyp-68b7.12

DIOPT Version :9

Sequence 1:NP_650933.2 Gene:Rlip / 42484 FlyBaseID:FBgn0026056 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_021324056.1 Gene:si:dkeyp-68b7.12 / 100151151 ZFINID:ZDB-GENE-141212-333 Length:1429 Species:Danio rerio


Alignment Length:329 Identity:63/329 - (19%)
Similarity:139/329 - (42%) Gaps:56/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 DIPLVVRDCIDFLQDHLKCEQIYKIEPIKTRLMHFKRLYNNREHDSAVDEL---NLPTACSLLKL 266
            |:|.|:|.|.:|::.|...:.||::..:.:.....:..:::........|:   ::....||.|.
Zfish    29 DVPQVLRSCSEFIEKHGIVDGIYRLSGVSSNTQKLRSEFDSEGSPDLYKEVYLQDIHCVSSLCKA 93

  Fly   267 FLRELPEPLLTTDLVARFEEVASHPKVTTQQAELQQLLEQLPKCNRTLLAWVLLHFDAVIQQERH 331
            :.||||.||||.:|..||.:..:......:..:::::|:.||..:...|.:::.|...:......
Zfish    94 YFRELPNPLLTYELYDRFADAVAVQLEDERLVKIREVLKDLPAPHYRTLEFLMRHLVKMSTFASE 158

  Fly   332 NKLNAQSLAMLLSPTLQMSHRL--------------------MVALLCHCNNLF----------- 365
            ..:::::||::.:|.|..|..:                    :..:|.|...||           
Zfish   159 TNMHSRNLAIVWAPNLLRSKDIESTGFNGTAAFMEVRVQSIVVEFVLTHVPELFPETGVSMERRK 223

  Fly   366 ----------ADVQLIKYVPPLTSTSPKLPDTPEDIQTELRKQDSLLSQIHSEMNAGFITKKREE 420
                      .|....|.:|.::|.:.    :|.|....:|...:::.  .::...|.:..::.:
Zfish   224 SLPSPSILSSQDDHFFKSLPLISSGNL----SPGDGPLPMRPYHAIID--GTDKRKGSLKGRKWK 282

  Fly   421 QLWEVQRIITQLKRKLRTFEKKQEKT----AEEVDNSSSAPPAVASEDTTDSKPAGTPAVSTNNS 481
            .::.:...:...::|.:...|.:|||    |:.:|:.|:...|:  ||:...:.|..|.|.::.|
Zfish   283 SIFNLGARLHDPRKKNKYCPKDKEKTSLRPAKSMDSLSTGTTAL--EDSKPPQAALPPLVLSSAS 345

  Fly   482 ISQE 485
            .|.|
Zfish   346 GSSE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RlipNP_650933.2 RhoGap_RalBP1 187..368 CDD:239846 38/206 (18%)
si:dkeyp-68b7.12XP_021324056.1 RhoGAP_CdGAP 13..207 CDD:239849 35/177 (20%)
MDN1 <692..1250 CDD:331582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D607176at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.