DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31191 and F59B8.1

DIOPT Version :9

Sequence 1:NP_001097850.3 Gene:CG31191 / 42477 FlyBaseID:FBgn0051191 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001293888.1 Gene:F59B8.1 / 177774 WormBaseID:WBGene00010316 Length:255 Species:Caenorhabditis elegans


Alignment Length:252 Identity:86/252 - (34%)
Similarity:124/252 - (49%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SATTNFVGKFTQS----------VRRIVQDVKDEG--------APSGMTRDEVIETNERLRSLRL 309
            |.:|..||...||          :..|:..:..||        ||:..:||.:|.|..||...|.
 Worm     2 SLSTPVVGLSPQSPSKRIKPKDVMLNILMSMTKEGASDGPQFVAPAKTSRDTLITTAYRLHRTRW 66

  Fly   310 RLEESYETAKKALINLMNKYGDSKSQRNIFQRYPMLKLMIKEVIRLETQYWTLVDIPRQEKQETV 374
            |:.|.|...|.||..|...|..|| :.|...||..|...::||..||.|||.|::||.||..|..
 Worm    67 RILEPYRRLKNALKKLQEDYLKSK-EANALMRYVKLGQSVREVAMLEKQYWKLLNIPAQEGTEDA 130

  Fly   375 PSYVMRACSIMEKTQKS-----GEGVKTSARLAEEAAERRERM--ERLEHMTTAQIEHENTQLIN 432
            ..||::...::|.|...     |.|....:.:.:.|....:.:  :.|:...:..:..|...|..
 Worm   131 NCYVVKIIELLEDTPTQLPPTRGIGALLQSTIGKPAEANVDTVLHDSLKARKSEDLVKECEGLYA 195

  Fly   433 DLYRLLKKYLGLRHLIRVLKEEYGSSKMYPIFPRYTMLKDMIKGIMHDPDYMEVCHE 489
            .||||.|||||||.||:.|.::|.:::|:||.|||.|||.|||..:..|::.::|||
 Worm   196 QLYRLTKKYLGLRRLIKELHDKYEATRMFPIVPRYAMLKKMIKATLRAPEFADICHE 252



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H106842
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016715
OrthoInspector 1 1.000 - - oto20284
orthoMCL 1 0.900 - - OOG6_121008
Panther 1 1.100 - - LDO PTHR21010
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16931
SonicParanoid 1 1.000 - - X13564
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.