DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grik and Ir7d

DIOPT Version :9

Sequence 1:NP_001262788.1 Gene:Grik / 42476 FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:264 Identity:48/264 - (18%)
Similarity:95/264 - (35%) Gaps:73/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 PAPAHSLEP----------------DMRSLVNKSFVVITAISEPYGMLK-ETSEKLEGNDQFEGF 443
            |....||||                .:::|......||.....||..:. ::|:.::|.|..:|.
  Fly   178 PTSCSSLEPVEIDIKDGDLWDVFPRRLKNLHGCPLSVIVWDIPPYMRINWKSSDPMDGLDGLDGL 242

  Fly   444 GIELIDELSKKLGFSYTWRLQEDN-KYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTSERESG 507
            .:.::   ::|:.|:......|.| ..||.....|.:.|..:.:.:.||::.|.....|.||.:.
  Fly   243 LLRIV---ARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAACTPERSTF 304

  Fly   508 VDFTIPFMSLGIGILFRKPMKEPPKLFSFM-SPFSGEVWLWLGLAYMGVSISMFVLGRLSPAEWD 571
            ::.|.|:..:...|:.:  .:....::..| .||....||.|. ..:|:.   :::|    :.|.
  Fly   305 LEATSPYSQMSYIIVLQ--ARGGYSIYEVMLFPFEKYTWLLLS-TILGLH---WIVG----SRWR 359

  Fly   572 NPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANL 636
            .|.|                                         :.|.|..:..::.:||.|::
  Fly   360 MPSP-----------------------------------------ILAGWMLWIFVIRASYEASV 383

  Fly   637 AAFL 640
            ..|:
  Fly   384 FNFI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377
ANF_receptor 53..374 CDD:279440
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 42/233 (18%)
Lig_chan 543..816 CDD:278489 14/98 (14%)
Ir7dNP_001138175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.