DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grik and Ir92a

DIOPT Version :9

Sequence 1:NP_001262788.1 Gene:Grik / 42476 FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:422 Identity:82/422 - (19%)
Similarity:149/422 - (35%) Gaps:118/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 DNKYGGI-DPKTGEWNGMLREIIDSRADM----------GITDLTMTSERESGVDFTIPFMSLGI 519
            || :||| |.::.:  |||.:|.:.|.:|          |||:.:.|..|.|            :
  Fly   311 DN-WGGIYDNESSD--GMLGDIYEQRVEMAIGCIYNWYDGITETSHTIARSS------------V 360

  Fly   520 GILFRKPMKEPPKLFSFMSPFSGEVWLWL-------------------GLAYMGVSISMFVLGRL 565
            .||...|...|....:.| ||:...||.|                   .|.|.|..:......:|
  Fly   361 TILGPAPAPLPSWRTNIM-PFNNRAWLVLISTLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKL 424

  Fly   566 SPAEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVS 630
            ..:..|.....|::|:.   ..||               ...||:.:....:.|     |:.|.:
  Fly   425 EKSMLDIFALFIQQPSA---PLSF---------------DRFAPRFFLATILCA-----TITLEN 466

  Fly   631 SYTANLAAFLTVESLVTPINDADDLSKNKGGVNYGAKIGGATF---NFFKESNYPTYQRM----- 687
            .|:..|.:.||......|::..:..:::      |.|....:.   :..:.|:..|.|.:     
  Fly   467 IYSGQLKSMLTFPFYSAPVDTIEKWAQS------GWKWSAPSIIWVHTVQSSDLETEQILARNFE 525

  Fly   688 ---YEFMRDNPQYMTNTNQEGVDRVENSNYAFLMESTTIEYIT----ERRCTLTQVGALLDEKGY 745
               |.:: .|..:|.|.. .|::|:.:.:.      :..:|::    |.|..|..  .|..:...
  Fly   526 VHDYSYL-SNVSFMPNYG-FGIERLSSGSL------SVGDYVSTEALENRIVLHD--DLYFDYTR 580

  Fly   746 GIAMRKNWPYRDTLSQAVLEMQEQGL------------LTKMKTKWWQEKRGGGACSDADEDSGA 798
            .:::| .|.....|::.:...||.||            :.|.|.:...:...|.....|.:    
  Fly   581 AVSIR-GWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQEVLMDLANGHKVKGAPQ---- 640

  Fly   799 VALEISNLGGVFLVMGVGSFFGIFVSLLEMVL 830
             ||::.|:.|...|:..|..|.....:.|:::
  Fly   641 -ALDVRNIAGALFVLAFGVAFAGCALVAELLI 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377
ANF_receptor 53..374 CDD:279440
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 72/371 (19%)
Lig_chan 543..816 CDD:278489 54/318 (17%)
Ir92aNP_001097845.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.