DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grik and Ir75a

DIOPT Version :9

Sequence 1:NP_001262788.1 Gene:Grik / 42476 FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster


Alignment Length:373 Identity:89/373 - (23%)
Similarity:144/373 - (38%) Gaps:78/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 GFGIELI--DELSKKLG--FSYTWRLQEDNKYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTS 502
            ||.:.||  |.|..|:.  ||.:|            .|:....|.:..::|..||:..|....|.
  Fly   243 GFHLTLILRDLLHCKMKFIFSDSW------------SKSDVVGGSVGAVVDQTADLTATPSLATE 295

  Fly   503 ER--------ESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLG--LAYMGVS- 556
            .|        |:|.     |.|:   .:||.|.....:...|:.|||..||...|  |:.:||. 
  Fly   296 GRLKYLSAIIETGF-----FRSV---CIFRTPHNAGLRGDVFLQPFSPLVWYLFGGVLSLIGVLL 352

  Fly   557 -ISMFVLGRLSPAEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAAS 620
             |:.::..:.....|           .|:...|..:....|.||...|.|.|.|::...|.:   
  Fly   353 WITFYMECKRMQKRW-----------RLDYLPSLLSTFLISFGAACIQSSSLIPRSAGGRLI--- 403

  Fly   621 WWFFTLILVSSYTANLAAFLTVESLV-TPINDADDLSKNK-------GGVNYGAKIGGATFNFFK 677
              :|.|.|:|....|....:.|.||: :|:.     ||.|       ..:..|.:....|.::..
  Fly   404 --YFALFLISFIMYNYYTSVVVSSLLSSPVK-----SKIKTMRQLAESSLTVGLEPLPFTKSYLN 461

  Fly   678 ESNYPT----YQRMYEFMRDNPQYMTNTNQEGVDRV-ENSNYAFLMESTT----IE-YITERR-C 731
            .|..|.    .:|..|....||:......| ||.|| :|..|.::.|:::    :| |.|.:. |
  Fly   462 YSRLPEIHLFIKRKIESQTQNPELWLPAEQ-GVLRVRDNPGYVYVFETSSGYAYVERYFTAQEIC 525

  Fly   732 TLTQVGALLDEKGYGIAMRKNWPYRDTLSQAVLEMQEQGLLTKMKTKW 779
            .|.:| ....|:.:...:.:|..|::......|.:.|.|:..|.::.|
  Fly   526 DLNEV-LFRPEQLFYTHLHRNSTYKELFRLRFLRILETGVYRKQRSYW 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377
ANF_receptor 53..374 CDD:279440
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 89/373 (24%)
Lig_chan 543..816 CDD:278489 60/260 (23%)
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 60/259 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.