DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grik and Ir7a

DIOPT Version :9

Sequence 1:NP_001262788.1 Gene:Grik / 42476 FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:462 Identity:89/462 - (19%)
Similarity:155/462 - (33%) Gaps:154/462 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VGSMATLPEFFKQAQQVG------LVTSDYRYIIGNLDWHTMDLEPYQHAGTNITGLRLVSPDSE 275
            |||...|..|.|...:|.      ||.|...:  ..|.:|..|:...:.....|.....:|..:|
  Fly    76 VGSEMALRTFQKPPAEVPASFVVFLVNSAQAF--NTLGFHFTDIHSTREFNFLILLTHRMSSRAE 138

  Fly   276 QVQEVAKALYESEEPFQNVSCPLTNSMALV---YDGVQLLAETYKHVNFRPVALSCNDDSAWDKG 337
            ::| |.:.:..:...|.      |:::.|:   .|||.|:                       ..
  Fly   139 RLQ-VLRDISRTCVRFH------TSNVILLTEKRDGVVLV-----------------------YA 173

  Fly   338 YTLVNYMKSLTLNGLTGPIRFDYEGLRTDFKLEVIELAVSGMQKIGQWSGEDGFQENR------- 395
            |.|:|....|::|                  ||:|::..:|:.:    .|.:....||       
  Fly   174 YRLLNMDCDLSVN------------------LELIDIYKNGLFR----HGHEARSFNRVLSLSGC 216

  Fly   396 -------PAP------AHSLEPDMRSLVNKSFVVITAISEPYGMLKETSEKLEGNDQFEGFGIEL 447
                   |.|      .:|.:|:.|:.:                     .:|.|.|         
  Fly   217 PLQVSWYPLPPFVSFIGNSSDPEERAQI---------------------WRLTGID--------- 251

  Fly   448 IDELSKKLGFSYTWR--LQED-NKYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTSERESGVD 509
             .||.|.|...:.:|  |:|. ||....|.| .:.:|...::|.|.:.:.|..::.:.:..|...
  Fly   252 -GELIKLLASIFDFRILLEEPCNKCLSPDIK-DDCSGCFDQVIISNSSILIGAMSGSHQHRSHFS 314

  Fly   510 FT----------IPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLGR 564
            ||          |..||...|.:.:..:           ||:..|||.|.::.:.:.:.:::..|
  Fly   315 FTSSYHQSSLVFIMHMSSQFGAVAQLAV-----------PFTVIVWLALVVSSLLLVLVLWMRNR 368

  Fly   565 LSPAEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILV 629
            |.....|.....::..|.|             :|..|:..|  .|::...|.:.|.|....|:|.
  Fly   369 LVCGRSDLASHALQVLTTL-------------MGNPLEARS--LPRSSRLRILYAGWLLLVLVLR 418

  Fly   630 SSYTANL 636
            ..|...|
  Fly   419 VVYQGKL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377 35/182 (19%)
ANF_receptor 53..374 CDD:279440 33/165 (20%)
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 47/239 (20%)
Lig_chan 543..816 CDD:278489 20/94 (21%)
Ir7aNP_572406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.