DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and AT2G24240

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_180001.1 Gene:AT2G24240 / 816958 AraportID:AT2G24240 Length:441 Species:Arabidopsis thaliana


Alignment Length:99 Identity:33/99 - (33%)
Similarity:49/99 - (49%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQ-DKSTLLAELF-GEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDK 67
            |:.||||..:.||..||.. .:.:....|| .|...|..:||  ..|:||:...|..:||.||..
plant     8 IKFNVGGRLFETTATTLANAGRDSFFGALFDDEWNLSPLEDS--ILFVDRNSDCFAVLLDLLRTG 70

  Fly    68 ALHLPEGFRERQRLLREAEHFKLTAMLECIRSER 101
            .|::|....|| .|.|||..:   .:|:.:|:.:
plant    71 DLNVPANIPER-LLHREASFY---GLLDHVRTAK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 32/93 (34%)
BTB 5..91 CDD:295341 31/87 (36%)
AT2G24240NP_180001.1 BTB_POZ_KCTD-like 8..90 CDD:349625 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.