DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd4

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001103120.1 Gene:Kctd4 / 691835 RGDID:1594637 Length:259 Species:Rattus norvegicus


Alignment Length:93 Identity:45/93 - (48%)
Similarity:59/93 - (63%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKALHL 71
            |||||..|.|...||.:...|.| |....|:.....|:.|.||:||||:|||::|:|||:..|.|
  Rat    37 LNVGGYLYITQRQTLTKYPDTFL-EGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLL 100

  Fly    72 PEGFRERQRLLREAEHFKLTAMLECIRS 99
            ||||||.|.|.:|||.|:|..:.|.::|
  Rat   101 PEGFRENQLLAQEAEFFQLKGLAEEVKS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 44/89 (49%)
BTB 5..91 CDD:295341 42/83 (51%)
Kctd4NP_001103120.1 BTB_POZ_KCTD4 34..119 CDD:349673 42/82 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X239
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.