DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd4

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001103120.1 Gene:Kctd4 / 691835 RGDID:1594637 Length:259 Species:Rattus norvegicus


Alignment Length:93 Identity:45/93 - (48%)
Similarity:59/93 - (63%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKALHL 71
            |||||..|.|...||.:...|.| |....|:.....|:.|.||:||||:|||::|:|||:..|.|
  Rat    37 LNVGGYLYITQRQTLTKYPDTFL-EGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLL 100

  Fly    72 PEGFRERQRLLREAEHFKLTAMLECIRS 99
            ||||||.|.|.:|||.|:|..:.|.::|
  Rat   101 PEGFRENQLLAQEAEFFQLKGLAEEVKS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 44/91 (48%)
H1_KCTD12-like 106..227 CDD:409026
Kctd4NP_001103120.1 BTB_POZ_KCTD4 34..119 CDD:349673 42/82 (51%)
KCTD4_C 138..259 CDD:437155
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.