DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and kctd16b

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001122224.1 Gene:kctd16b / 569756 ZFINID:ZDB-GENE-060117-2 Length:423 Species:Danio rerio


Alignment Length:261 Identity:109/261 - (41%)
Similarity:154/261 - (59%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEIIELNVGGVSYTTTLATLLQDKSTLLAELF---GEGRDSLAKDSKGRYFLDRDGVLFRYILDF 63
            |::|||||||..|.|...||:....:||.::|   ....:.||:|.|||||:||||.||||:||:
Zfish    15 PDVIELNVGGQVYYTRYTTLINTPGSLLGKIFSPKNNASNDLARDPKGRYFIDRDGFLFRYVLDY 79

  Fly    64 LRDKALHLPEGFRERQRLLREAEHFKLTAML-------------ECIRS----------ERDARP 105
            ||||.:.||:.|.|:.||.:|||:|:|..::             |.|.|          :|...|
Zfish    80 LRDKQVVLPDHFPEKGRLRKEAEYFQLPDLVKLLTPDDLKPSSDEYIHSDYEDGSQGSDQRMCPP 144

  Fly   106 P---------GCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVAQCREVFGDTLNESRDPDHG 161
            |         |.:|:|||||...|::...|.|||::.||::|||:|..:||||:|||||||||. 
Zfish   145 PSLILADRKSGFLTVGYRGSCTMGRENRTDAKFRRVPRIMICGRIALAKEVFGETLNESRDPDR- 208

  Fly   162 GTDRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFI 226
            ..|:|||||:||..::|::||.|.:.|::|. :|.|....|....    .|::..|:.|.|:||.
Zfish   209 TADKYTSRFYLKFKHLERSFDMLSECGFQMV-ACNSSVTASIINQ----HTDDKIWSSYTEYVFY 268

  Fly   227 R 227
            |
Zfish   269 R 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 48/107 (45%)
BTB 5..91 CDD:295341 46/88 (52%)
kctd16bNP_001122224.1 BTB 16..112 CDD:197585 47/95 (49%)
BTB 18..109 CDD:295341 47/90 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5445
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3746
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579292at2759
OrthoFinder 1 1.000 - - FOG0001212
OrthoInspector 1 1.000 - - otm25414
orthoMCL 1 0.900 - - OOG6_106901
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2965
SonicParanoid 1 1.000 - - X239
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.