DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and kctd14

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_693041.2 Gene:kctd14 / 564616 ZFINID:ZDB-GENE-120215-239 Length:241 Species:Danio rerio


Alignment Length:152 Identity:47/152 - (30%)
Similarity:78/152 - (51%) Gaps:30/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDK 67
            :::.||:||..::|||.|:.:..::.||||.  ...|...||:||||:||||.||.:||::||.:
Zfish    22 QVVHLNIGGHVFSTTLGTIRKFPNSTLAELI--NGSSKRMDSEGRYFIDRDGTLFTHILEYLRTE 84

  Fly    68 AL---HLPEGFRERQRLLREAEHFKLTAMLECI------------RSERDARPPGCITIGYRGSF 117
            .|   ||       |.:.:||.::.:..:::.|            |.:..||.|     .||.:.
Zfish    85 KLPCEHL-------QEVHKEAIYYDIKPLVKAIEETPQFFGETVGRQQFLARVP-----NYRENL 137

  Fly   118 Q-FGKDGLADVKFRKLSRILVC 138
            : ..:...|:....:.|.|:||
Zfish   138 EVIVRVARAEAIASRHSNIIVC 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 35/94 (37%)
BTB 5..91 CDD:295341 35/88 (40%)
kctd14XP_693041.2 BTB 24..112 CDD:197585 36/96 (38%)
BTB 24..106 CDD:295341 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.