DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and kctd12.2

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001029191.1 Gene:kctd12.2 / 553403 ZFINID:ZDB-GENE-060117-4 Length:271 Species:Danio rerio


Alignment Length:263 Identity:115/263 - (43%)
Similarity:158/263 - (60%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDS-LAKDSKGRYFLDRDGVLFRYILDFLRD 66
            |||||||||..|.|..:|||...::||..:|.:.:.: |..|||||:||||||.|||||||:|||
Zfish    15 EIIELNVGGQVYVTRHSTLLSVPNSLLWTMFSQKKPAELTTDSKGRFFLDRDGFLFRYILDYLRD 79

  Fly    67 KALHLPEGFRERQRLLREAEHFKLTAMLECIR---------SER--------------------- 101
            :.|.||:.|:|:..||:|||:|:|..:.:.::         ||.                     
Zfish    80 QTLVLPDYFKEKASLLKEAEYFQLQDLAKRLKPAVSKENSISEEVCQSDPEEAALAGTSMTCTGP 144

  Fly   102 -----DARPPGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVAQCREVFGDTLNESRDPDHG 161
                 |||..|.||||||||:..|:|...|.|||:::||.|||:.:..:||||:|||||||||. 
Zfish   145 RSPSLDARKTGFITIGYRGSYTIGRDLQQDAKFRRVARITVCGKTSLAKEVFGETLNESRDPDR- 208

  Fly   162 GTDRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGTAGSAA-EPKPGVDTEENRWNHYNEFVF 225
            ..:|||||::||:.::|||||.|.:.|:.|.....:||...|: :|     .|:..|..|.|:||
Zfish   209 PPERYTSRYYLKYNFLEQAFDRLAEVGFHMVACSSTGTCAYASNDP-----NEDKIWTSYTEYVF 268

  Fly   226 IRD 228
            .|:
Zfish   269 CRE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 49/92 (53%)
BTB 5..91 CDD:295341 48/86 (56%)
kctd12.2NP_001029191.1 BTB 17..108 CDD:197585 49/90 (54%)
BTB 17..107 CDD:295341 49/89 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593957
Domainoid 1 1.000 124 1.000 Domainoid score I5445
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3746
OMA 1 1.010 - - QHG49144
OrthoDB 1 1.010 - - D1579292at2759
OrthoFinder 1 1.000 - - FOG0001212
OrthoInspector 1 1.000 - - otm25414
orthoMCL 1 0.900 - - OOG6_106901
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2965
SonicParanoid 1 1.000 - - X239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.