DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd18

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001153336.2 Gene:Kctd18 / 51960 MGIID:3603813 Length:417 Species:Mus musculus


Alignment Length:86 Identity:34/86 - (39%)
Similarity:50/86 - (58%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDK 67
            :|:.|||||..||....:|.:.|.::||.:| .||..|..|..|...::|||.||:||||:|..:
Mouse    11 DILRLNVGGCIYTARRESLCRFKDSMLASMF-SGRFPLKTDESGACIINRDGHLFKYILDYLHGE 74

  Fly    68 ALHLPEGFRERQRLLREAEHF 88
             :..|...:.|..|..||::|
Mouse    75 -VQTPSDEQTRAALQEEADYF 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 34/86 (40%)
H1_KCTD12-like 106..227 CDD:409026
Kctd18NP_001153336.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.