DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and kctd6b

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001002329.1 Gene:kctd6b / 436601 ZFINID:ZDB-GENE-040718-14 Length:237 Species:Danio rerio


Alignment Length:101 Identity:40/101 - (39%)
Similarity:63/101 - (62%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKAL 69
            :.|||||..|||:::||.:...::|..:| .|.....:|::|.||:||||.||||||:|||...|
Zfish    14 VTLNVGGHLYTTSISTLQRYPDSMLGAMF-RGDFPTTRDAQGNYFIDRDGTLFRYILNFLRTSEL 77

  Fly    70 HLPEGFRERQRLLREAEHFKLTAMLECIRSERDARP 105
            .||..|.|...|.:||:.:::..:::|:...:...|
Zfish    78 TLPVDFTELDLLRKEADFYQIEPLIQCLNDPKPLYP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 38/91 (42%)
BTB 5..91 CDD:295341 38/85 (45%)
kctd6bNP_001002329.1 BTB 14..104 CDD:197585 38/90 (42%)
BTB 14..102 CDD:295341 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X239
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.