DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and F22E5.23

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001379012.1 Gene:F22E5.23 / 43578479 WormBaseID:WBGene00305112 Length:99 Species:Caenorhabditis elegans


Alignment Length:86 Identity:17/86 - (19%)
Similarity:33/86 - (38%) Gaps:14/86 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VLFRYILDFLRDKALHLPEGFRERQRLLREAEHFKL-------------TAMLECIRSERDAR-P 105
            ::..|:.|..|..::.||:.|..|..:...:..|::             |.|.|....:::.. |
 Worm     9 LIIGYVHDTDRLHSMSLPKNFNVRAFIDTHSNQFEIYFKEHKNHKFWTATIMTEHNGHQQNFELP 73

  Fly   106 PGCITIGYRGSFQFGKDGLAD 126
            |.....|...||..|.:.:.:
 Worm    74 PPIFDWGQTSSFLLGLEKMIE 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 11/56 (20%)
H1_KCTD12-like 106..227 CDD:409026 5/21 (24%)
F22E5.23NP_001379012.1 None

Return to query results.
Submit another query.