DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and CG14647

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster


Alignment Length:65 Identity:24/65 - (36%)
Similarity:40/65 - (61%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLL-QDKSTLLAELF---GEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            ::|||||..|.||:.||: ::..::||.:|   |..:.| .:|.:|.|.:||....|..|:::||
  Fly    36 VKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPS-ERDEQGAYLIDRSPRYFEPIINYLR 99

  Fly    66  65
              Fly   100  99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 24/65 (37%)
H1_KCTD12-like 106..227 CDD:409026
CG14647NP_649465.6 BTB_POZ_KCTD9 34..134 CDD:349677 24/65 (37%)
YjbI 161..322 CDD:440968
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.