DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and kctd15

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_989239.1 Gene:kctd15 / 394848 XenbaseID:XB-GENE-944069 Length:255 Species:Xenopus tropicalis


Alignment Length:244 Identity:75/244 - (30%)
Similarity:117/244 - (47%) Gaps:57/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKA 68
            :.::|||..||::||||.:...:.::.|| .|.:.:..|| |..||:||||.:|||||.|||...
 Frog    32 VHIDVGGHMYTSSLATLTKYPDSRISRLF-NGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTSK 95

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAM---LECIRSERDAR----PPGCITIGYRGSFQFGKDGLAD 126
            |.|||.|:|...|..||::::|..|   ||..:.:::.|    |..|:.:  |.:...|:     
 Frog    96 LLLPEDFKEFNLLYEEAKYYQLHPMVKELERWKQDKEHRKHFQPCDCLVV--RVTPDLGE----- 153

  Fly   127 VKFRKLSRILVCGRVAQCREVF---GDTLNES------RDPDHGGTDRYTSRFFLK-HCYIE--Q 179
                   ||.:.|..|...|:|   ||.:..|      :||.|      ..||.|. :|.:.  |
 Frog   154 -------RIALSGEKALIEEIFPETGDVMCNSVNAGWNQDPTH------VIRFPLNGYCRLNSVQ 205

  Fly   180 AFDNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIRD 228
            ..:.:...|:.:|.|||.           |||:.:     ::|:|..|:
 Frog   206 VLERMFQKGFHVAASCGG-----------GVDSSQ-----FSEYVLCRE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 42/95 (44%)
BTB 5..91 CDD:295341 38/86 (44%)
kctd15NP_989239.1 BTB_POZ_KCTD15 29..127 CDD:349696 42/95 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.