DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and twz

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster


Alignment Length:101 Identity:39/101 - (38%)
Similarity:65/101 - (64%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKA 68
            :.::|||..||::|.||.:...:.||:|| .|:..:..|| |..||:||||.:||:||:|:|:..
  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLF-NGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSR 200

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAMLECIRSERDAR 104
            |.:.|.|.:.:.||.||.::::..|::.:.|.|..|
  Fly   201 LLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 36/92 (39%)
BTB 5..91 CDD:295341 35/86 (41%)
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 36/93 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.