DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd8

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001093642.1 Gene:Kctd8 / 364148 RGDID:1312020 Length:476 Species:Rattus norvegicus


Alignment Length:288 Identity:112/288 - (38%)
Similarity:154/288 - (53%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEG--------RDSLAKDSKGRYFLDRDGVLFR 58
            ||::||||||..|.|..:|||....:.||.:|...        |..|.:||:.|:|:||||.|||
  Rat    43 PEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGDLPRDSRARFFIDRDGFLFR 107

  Fly    59 YILDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLEC----IRSERDARPPGC----------- 108
            |:||:||||.|.|||.|.|::|||||||.|:||.:::.    :..:......||           
  Rat   108 YVLDYLRDKQLALPEHFPEKERLLREAEFFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNLSQG 172

  Fly   109 ---------------------------------------ITIGYRGSFQFGKDGLADVKFRKLSR 134
                                                   :|:|||||:...:|..||.|||:::|
  Rat   173 SSDALLLRGAAAGAPSSSGAHGVSGVVSGGSAPDKRSGFLTLGYRGSYTTVRDNQADAKFRRVAR 237

  Fly   135 ILVCGRVAQCREVFGDTLNESRDPDHGGTDRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGT 199
            |:||||:|..:||||||||||||||. ..::|||||:||..|:|||||.|.:.|:.|.....|||
  Rat   238 IMVCGRIALAKEVFGDTLNESRDPDR-QPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGT 301

  Fly   200 AGSAAEPKPGVDTEENRWNHYNEFVFIR 227
            |....:.:     ::..|:.|.|::|.|
  Rat   302 AAFVNQYR-----DDKIWSSYTEYIFFR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 50/103 (49%)
BTB 5..91 CDD:295341 48/93 (52%)
Kctd8NP_001093642.1 potassium channel tetramerization domain 46..145 50/98 (51%)
BTB 46..145 CDD:197585 50/98 (51%)
BTB 46..142 CDD:295341 50/95 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18464
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.