DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd11

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001102301.1 Gene:Kctd11 / 363634 RGDID:1307125 Length:232 Species:Rattus norvegicus


Alignment Length:66 Identity:26/66 - (39%)
Similarity:39/66 - (59%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SLAKDSKGRYFLDRDGVLFRYILDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLECIRSERDA 103
            :|.....|.||:||||..||:||:|||...|.||.|:.|...|..||:.:::..:|:.:|....:
  Rat    15 NLNPQGDGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLKAEADFYQIRPLLDALRELEAS 79

  Fly   104 R 104
            |
  Rat    80 R 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 24/57 (42%)
BTB 5..91 CDD:295341 23/51 (45%)
Kctd11NP_001102301.1 BTB_POZ <1..65 CDD:365784 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.