DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd14

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_006229857.1 Gene:Kctd14 / 308836 RGDID:1306430 Length:266 Species:Rattus norvegicus


Alignment Length:146 Identity:39/146 - (26%)
Similarity:76/146 - (52%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKA 68
            ::||||||..||||:.||::...:..:|:........ ||::||:|:||.|..|..:||:||...
  Rat    51 VVELNVGGQFYTTTMGTLMKHPGSKFSEILSRSAKHY-KDAQGRFFIDRPGTYFGPLLDYLRTGQ 114

  Fly    69 L---HLPEGFRERQRLLREAEHFKLTAMLECIR------SERDARPPGCITI-GYRGSFQFGKD- 122
            :   ::||       :.:||:.:::..:::.:.      .|:.||....:.: .||.:.:.... 
  Rat   115 VPTEYIPE-------VYQEAKFYQIHPLVKLLEDKPQIFGEQVARMQFLMGVPNYRENLEVLLHL 172

  Fly   123 GLADVKFRKLSRILVC 138
            ..|:....:.|:::||
  Rat   173 ARAEAVAMRSSKVVVC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 30/94 (32%)
BTB 5..91 CDD:295341 30/88 (34%)
Kctd14XP_006229857.1 BTB 52..142 CDD:197585 30/97 (31%)
BTB 52..135 CDD:295341 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.